Minimum number of tobacco ZIM genes: 9
Count of tobacco ZIM sequences: 9
Pfam accession: Zim
SHOULD possess Zim domain but SHOULD NOT possess GATA domain
This short motif is found in a variety of plant transcription factors that contain GATA domains as well as other motifs. The most conserved amino acids form the pattern TIFF/YXG. This domain may be involved in binding DNA. The ZIM family gene is that contains ZIM motif but no belong to GATA family.
The deduced protein has a modular structure with a putative single C2-C2 zinc-finger motif distantly related to a GATA-1-type finger, a basic region with a sequence resembling a nuclear localization signal, and an acidic region. The gene seemed to have been formed by the exon-shuffling during its molecular evolution, since individual domains are encoded by discrete exons. RNA gel blot analysis showed its expression in shoot apex and flowers in the reproductive phase. The gene was named ZIM for Zinc-finger protein expressed in Inflorescence Meristem. The nuclear localization of ZIM was detected using GFP as a reporter. These results suggest that ZIM is a putative transcription factor involved in inflorescence and flower development.
By differential screening of an arrayed normalized cDNA library
from the inflorescence apex in Arabidopsis, a cDNA clone having a deduced
amino acid sequence with a motif for a zinc finger was isolated as one of the
genes expressed specifically in the reproductive phase. The deduced protein
has a modular structure with a putative single C2-C2 zinc-finger motif
distantly related to a GATA-1-type finger, a basic region with a sequence
resembling a nuclear localization signal, and an acidic region. The gene
seemed to have been formed by the exon-shuffling during its molecular
evolution, since individual domains are encoded by discrete exons. RNA gel
blot analysis showed its expression in shoot apex and flowers in the
reproductive phase. The gene was named ZIM for Zinc-finger protein expressed
in Inflorescence Meristem. The nuclear localization of ZIM was detected using
GFP as a reporter. These results suggest that ZIM is a putative transcription
factor involved in inflorescence and flower development.
Nishii, A; Takemura, M; Fujita, H; Shikata, M; Yokota, A; Kohchi, T. Characterization of a novel gene encoding a putative single zinc-finger protein, ZIM, expressed during the reproductive phase in Arabidopsis thaliana. Biosci. Biotechnol. Biochem. 2000. 64(7):1402-9 PMID: 10945256
The ZIM domain is short.
Number of contigs: 6
Number of singlets: 3
Total minimum number – 9
|
Locus |
Description |
NCBI |
| ZIM_2 | [comment=Complete ZIM domain PKTPAGPAQLTIFYVGSVCVYDNVSLEKVNALDL (Similar to Old gene 7)] [gss=CHO_OF440xp24f1.ab1, CHO_OF3160xk08f1.ab1] |
ET046469 ET043478 |
| ZIM_7 | [comment=Complete ZIM domain KEPKAAQLTMFYDGKVIVFDDFPANKARAEML (Old ZIM1)] [gss=CHO_OF4891xa04r1.ab1, CHO_OF4747xa10f1.ab1] |
ET048917 ET048123 |
| ZIM_14 | [comment=Last 12 aa ZIM domain. QMQAKAIIYLASR Divergent like AT1G30135.1] [gss=CHO_OF3131xm04f1.ab1, CHO_OF4422xc08f1.ab1, CHO_OF5011xj14f1.ab1] |
ET043397 ET046510 ET049851 |
| ZIM_15 | [comment=Complete ZIM dom. KSEPEKAQMTIFYGGQVIVFDDFPADKANEIMKLAT (Old gene 2)] [gss=CHO_OF4198xe20f1.ab1, CHO_OF5047xj06r1.ab1, CHO_OF4679xl09r1.ab1] |
ET045691 ET050141 ET047793 |
| ZIM_16 | [comment=Last 12 aa ZIM domain. Divergent like AT1G30135.1 MQAKAIIYLASR] [gss=CHO_OF4920xb08r1.ab1, CHO_OF3488xh23f1.ab1, CHO_OF3104xh02r1.ab1] |
ET049088 ET044245 ET043320 |
| ZIM_18 | [comment=Missing first 9aa ZIM domain.MFYDGKVIVFDDFPADKARAVMLLASK (Old gene 9)] [gss=CHO_OF573xm03r1.ab1, CHO_OF4426xc06f1.ab1, CHO_OF5092xk11r1.ab1] |
ET050911 ET046537 ET050423 |
| ZIM_29 | [comment=Full ZIM. Complete gene. SEPEKAQMTIFYGGQVIVFNDFPADKAKEIMLMAS (Old gene 4)] [gss=CHO_OF4673xd05r1.ab1, CHO_OF4673xd05f1.ab1, CHO_OF402xb16f2.ab1, CHO_OF402xb16r1.ab1] |
ET047769 ET047768 ET045083 ET045084 |
| ZIM_37 | [comment=GEANLNQLTLSFRGQVFVFDGVTTHKVSTL missing last 9 aa (up to KV), otherwise full] [gss=CHO_OF4303xf19f1.ab1, CHO_OF5079xe09f1.ab1, CHO_OF4773xi11r1.ab1, CHO_OF5008xg22f1.ab1, CHO_OF4720xp23r1.ab1] |
ET046189 ET050350 ET048296 ET049834 ET048004 |
| ZIM_43 | [comment=VDTSAGQMTIFYSGKVNVYDDVPADKV missing last 6-9 aa (up to KV), otherwise full (Old gene 5)] [gss=CHO_OF4967xn15r1.ab1, CHO_OF367xg21r5.ab1, CHO_OF367xg21r1.ab1, CHO_OF5070xk13f1.ab1, CHO_OF441xd17f2.ab1] |
ET049493 ET044615 ET044614 ET050296 ET046505 |
| ZIM_51 | [comment=EKSESEQLTIFYAGIVHVYDNLPVEKVQ missing last 8 aa (up to KV), otherwise full (Old gene 3)] [gss=CHO_OF3685xi16f1.ab1, CHO_OF4991xh05r1.ab1, CHO_OF3685xi16r1.ab1, CHO_OF4990xn20r1.ab1, CHO_OF4206xm23r1.ab1, CHO_OF360xj12f1.ab1, CHO_OF4569xa10f1.ab1] |
ET044643 ET049693 ET044644 ET049691 ET045754 ET044431 ET047129 |
| ZIM_54 | [comment=Complete ZIM gene SEPEKAQMTIFYGGQVIVFNDFPADKAKEIMLMASC (Old gene 6)] [gss=CHO_OF267xe10f1.ab1, CHO_OF164xj09f2.ab1, CHO_OF164xj09f1.ab1, CHO_OF291xj03r1.ab1, CHO_OF158xg03r1.ab1, CHO_OF4726xc20f1.ab1, CHO_OF3252xc22f1.ab1, CHO_OF009xb22r1.ab1, CHO_OF328xb24r1.ab1, CHO_OF3255xa03r1.ab1, CHO_OF4925xk14r1.ab1, CHO_OF291xj03f1.ab1] |
ET042896 ET042352 ET042351 ET042983 ET042328 ET048027 ET043728 ET041695 ET043858 ET043745 ET049136 ET042982 |
| ZIM_58 | [comment=Full ZIM domain KELKAAQLSIFYGGKVIMFDDFPADKARAMMLLASK (Old gene 8)] [gss=CHO_OF4920xo24f1.ab1] |
ET049099 |
| ZIM_63 | [comment=GSGASDQLTLSFQGEVYVFDAVSPEKV Full except last 9 aa] [gss=CHO_OF633xl11r1.ab1] |
ET051056 |
| ZIM_66 | [comment=Last 8 aa] [gss=CHO_OF4621xl01r1.ab1] |
ET047517 |
| Family | Genbank ID | Name |
Paul J Rushton
Marta T. Bokowiec
Xianfeng (Jeff) Chen
Thomas (Tom) W Laudeman
Jennifer F. Brannock
Michael P. Timko