>MYB-related_15  [length=810] [hit_def=KR2B.102L01F.051227T7 KR2B Nicotiana tabacum cDNA clone KR2B.102L01, mRNA sequence] [comment=full length] [delivery_date=2007-05-03]
AAATCGCCTCCTTAGAACCAACATCCTCCACGTTTTCATAGGATGCTGCA
AGAGATTTAGCATCAAGAACTTCTATACCATTCTCAAACACAGTGCTAAC
ATGCAAGGCACTATCAACATGTTTCACTGTTGGCTGAATGCTTTTATACC
CAGTCCTCCCTGGCTGCCGAGAACCCCGCCCACTTGCCATAGCATGTAGA
TTTCTCCATTTATCCTGTCCAATCAAGACCAGGTTCATCAGAGCAACTTT
ACTTTGAGCATAACTATGGGAAAACCACAAATATTCCAGCCCGAGAAAGT
ATAAGCTTCCCCAATAGGTAACAAGCAACATAAGTTAACTGTGTTGTCTA
ATACCTTAATGTCCACATTTGAACGAGAACGCAACACACCAGCAAACTCT
GGATCTTTGAGTATGGTGCTCCACTTGCCAACCCCATACTTAGCAACACC
CAACTTAAGGGCAGCTTCTTCTTCTGATGTCCACTTCTGCTTTGGTGCAC
CCATAATAGGTTGATGCCTTTTTGACACCGACGCAGAATTGAGCTTCCCT
ACCTATAGAGCCATCTCACTTTTCAATAAACAAATATCTGAATGTGGCTA
AAGAAAAGTAAATACCCAAGAATAAATGATCAATAAGAACATAAGCAGGA
CAAACTATAATCTGAAATTATATGACAGAAGATATTCATTTGTTAACTAT
GTTTCTGTACACGAGCGCATAAGAATATTCAGCAGCTACACGCTGTTCCA
AAAAAAAAAAAAAATGTAACACCAGTCTAAAATTTCAGTATACAATAATA
CAAAAGAAAG


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition
MYB-related_15 EB444124 3.11236e-119 428.681 KR2B.102L01F.051227T7 KR2B Nicotiana tabacum cDNA clone KR2B.102L01, mRNA sequence


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_15 BAB89031 2.07871e-15 85.1149 putative single myb histone 6 [Oryza sativa (japonica cultivar-group)]
MYB-related_15 AAF76448 4.63088e-15 83.9593 Contains similarity to DNA-binding protein MYB1 from Petroselinum crispum gi|7488946 and contains MYB-DNA-binding PF|00249 and linker-Histone PF|00538 domains. [Arabidopsis thaliana]
MYB-related_15 AAM65540 4.63088e-15 83.9593 DNA-binding protein PcMYB1, putative [Arabidopsis thaliana]
MYB-related_15 AAL73438 4.63088e-15 83.9593 telomere repeat binding factor 1 [Arabidopsis thaliana]
MYB-related_15 AAL73123 4.63088e-15 83.9593 telomere repeat binding factor 1 [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET049867

ET047013

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_15
>MYB-related_15_1 [tobfac_id=MYB-related_15] [frame=1]
KSPP*NQHPPRFHRMLQEI*HQELLYHSQTQC*HARHYQHVSLLAECFYTQSSLAAENPA
HLP*HVDFSIYPVQSRPGSSEQLYFEHNYGKTTNIPARESISFPNR*QAT*VNCVV*YLN
VHI*TRTQHTSKLWIFEYGAPLANPILSNTQLKGSFFF*CPLLLWCTHNRLMPF*HRRRI
ELPYL*SHLTFQ*TNI*MWLKKSKYPRINDQ*EHKQDKL*SEII*QKIFIC*LCFCTRAH
KNIQQLHAVPKKKKNVTPV*NFSIQ*YKRK
>MYB-related_15_2 [tobfac_id=MYB-related_15] [frame=2]
NRLLRTNILHVFIGCCKRFSIKNFYTILKHSANMQGTINMFHCWLNAFIPSPPWLPRTPP
TCHSM*ISPFILSNQDQVHQSNFTLSITMGKPQIFQPEKV*ASPIGNKQHKLTVLSNTLM
STFERERNTPANSGSLSMVLHLPTPYLATPNLRAASSSDVHFCFGAPIIG*CLFDTDAEL
SFPTYRAISLFNKQISECG*RKVNTQE*MINKNISRTNYNLKLYDRRYSFVNYVSVHERI
RIFSSYTLFQKKKKM*HQSKISVYNNTKEX
>MYB-related_15_3 [tobfac_id=MYB-related_15] [frame=3]
IASLEPTSSTFS*DAARDLASRTSIPFSNTVLTCKALSTCFTVG*MLLYPVLPGCREPRP
LAIACRFLHLSCPIKTRFIRATLL*A*LWENHKYSSPRKYKLPQ*VTSNIS*LCCLIP*C
PHLNENATHQQTLDL*VWCSTCQPHT*QHPT*GQLLLLMSTSALVHP**VDAFLTPTQN*
ASLPIEPSHFSINKYLNVAKEK*IPKNK*SIRT*AGQTII*NYMTEDIHLLTMFLYTSA*
EYSAATRCSKKKKKCNTSLKFQYTIIQKKX
>MYB-related_15_4 [tobfac_id=MYB-related_15] [frame=-1]
LSFVLLYTEILDWCYIFFFFWNSV*LLNILMRSCTET*LTNEYLLSYNFRL*FVLLMFLL
IIYSWVFTFL*PHSDICLLKSEMAL*VGKLNSASVSKRHQPIMGAPKQKWTSEEEAALKL
GVAKYGVGKWSTILKDPEFAGVLRSRSNVDIKVLDNTVNLCCLLPIGEAYTFSGWNICGF
PIVMLKVKLL**TWS*LDRINGEIYMLWQVGGVLGSQGGLGIKAFSQQ*NMLIVPCMLAL
CLRMV*KFLMLNLLQHPMKTWRMLVLRRRF
>MYB-related_15_5 [tobfac_id=MYB-related_15] [frame=-2]
FFCIIVY*NFRLVLHFFFFLEQRVAAEYSYALVYRNIVNK*ISSVI*FQIIVCPAYVLID
HLFLGIYFSLATFRYLFIEK*DGSIGREAQFCVGVKKASTYYGCTKAEVDIRRRSCP*VG
CC*VWGWQVEHHTQRSRVCWCVAFSFKCGH*GIRQHS*LMLLVTYWGSLYFLGLEYLWFS
HSYAQSKVALMNLVLIGQDKWRNLHAMASGRGSRQPGRTGYKSIQPTVKHVDSALHVSTV
FENGIEVLDAKSLAASYENVEDVGSKEAIX
>MYB-related_15_6 [tobfac_id=MYB-related_15] [frame=-3]
FLLYYCILKF*TGVTFFFFFGTACSC*IFLCARVQKHS*QMNIFCHIISDYSLSCLCSY*
SFILGYLLFFSHIQIFVY*KVRWLYR*GSSILRRCQKGINLLWVHQSRSGHQKKKLPLSW
VLLSMGLASGAPYSKIQSLLVCCVLVQMWTLRY*TTQLTYVACYLLGKLILSRAGIFVVF
P*LCSK*SCSDEPGLDWTG*MEKSTCYGKWAGFSAAREDWV*KHSANSETC**CLAC*HC
V*EWYRSS*C*ISCSIL*KRGGCWF*GGDX


Contact:

pr8y@virginia.edu