>MYB-related_23  [length=840] [hit_def=Hypothetical protein [Arabidopsis thaliana]] [comment=missing last 10 amino acids very divergent ] [delivery_date=2007-05-03]
ACTTATCATGTTTTTATGTTACTTCTACAAAATTAGAGATATGCGAAAAG
ACCGTTACAGTGCCTTAAAACTAGAGTCTATTTCTAAACATTAATAATAG
TTGACTAATCCTAATTAGTTATCATTTTAATAACATAAGGGCCCCACGAA
ATCTATTTCTACTAAAACTATTAAAAAAAAAAAAAACACCCGACAGAAGA
ACAATGATTCTAACGATACGAAAAATCAGGTACTACGTACGTTAAATTAA
AAACAGAGAAGATTAGACCAAACAAGACAAATAAAAGGATATTTGTCGTT
AATAATAAGAATGTCACTTAACGTAAATTAATGTGAACCTCAGGGGTGAA
ATAGTAAGGACAGATGGTACGAGAACGAAGCTCCGAAGCGACGACGTTCC
AATCTTGTGTCCCATGCCGGAGAACAGCGCCACCTAGGATTAGTTCCTCC
CACGTACCCCACCTCCTTTTTCCTGACCCCACCACCATCGTTTTTGTCCG
AACACGTGTACGACTGAGAACAGTTTTTTTGTCCACATGAACGGCTCAGA
TGATTTGAATGGTTAAAAATCACCACCAAAACAAGTTTCGAATTCTAAAT
GATCAAGCTCTTGTACCACGCGCACCCTGCTCACGTTAACATCAACCGCC
GGTACCACCACGTAGGCCGTTTCTCCGATGAATATAACCGGAGAAAATAA
AAAGAAGAAAAAAAGAAAAAAAGATGGTTGAATAATTTGAAATCAGAAAA
AGATCACGAGAAAGGGAGGGAGAAAAATAGGGTTTGTATGTAGGAAAATT
ATAAAAAGGTTGAAAAGGTGTTTTTATATTTTCTTTTATA


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_23 AAU95444 1.6276e-10 68.9366 At1g61215 [Arabidopsis thaliana]
MYB-related_23 AAB71473 1.6276e-10 68.9366 Hypothetical protein [Arabidopsis thaliana]
MYB-related_23 AAT85722 1.6276e-10 68.9366 At1g61215 [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET047612

ET046028

ET043712

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_23
>MYB-related_23_1 [tobfac_id=MYB-related_23] [frame=1]
TYHVFMLLLQN*RYAKRPLQCLKTRVYF*TLIIVD*S*LVIILIT*GPHEIYFY*NY*KK
KKHPTEEQ*F*RYEKSGTTYVKLKTEKIRPNKTNKRIFVVNNKNVT*RKLM*TSGVK**G
QMVRERSSEATTFQSCVPCRRTAPPRISSSHVPHLLFPDPTTIVFVRTRVRLRTVFLST*
TAQMI*MVKNHHQNKFRILNDQALVPRAPCSR*HQPPVPPRRPFLR*I*PEKIKRRKKEK
KMVE*FEIRKRSREREGEK*GLYVGKL*KG*KGVFIFSFI
>MYB-related_23_2 [tobfac_id=MYB-related_23] [frame=2]
LIMFLCYFYKIRDMRKDRYSALKLESISKH***LTNPN*LSF**HKGPTKSISTKTIKKK
KNTRQKNNDSNDTKNQVLRTLN*KQRRLDQTRQIKGYLSLIIRMSLNVN*CEPQG*NSKD
RWYENEAPKRRRSNLVSHAGEQRHLGLVPPTYPTSFFLTPPPSFLSEHVYD*EQFFCPHE
RLR*FEWLKITTKTSFEF*MIKLLYHAHPAHVNINRRYHHVGRFSDEYNRRK*KEEKKKK
RWLNNLKSEKDHEKGREKNRVCM*ENYKKVEKVFLYFLLX
>MYB-related_23_3 [tobfac_id=MYB-related_23] [frame=3]
LSCFYVTSTKLEICEKTVTVP*N*SLFLNINNS*LILISYHFNNIRAPRNLFLLKLLKKK
KTPDRRTMILTIRKIRYYVR*IKNRED*TKQDK*KDICR***ECHLT*INVNLRGEIVRT
DGTRTKLRSDDVPILCPMPENSAT*D*FLPRTPPPFS*PHHHRFCPNTCTTENSFFVHMN
GSDDLNG*KSPPKQVSNSK*SSSCTTRTLLTLTSTAGTTT*AVSPMNITGENKKKKKRKK
DG*II*NQKKITRKGGRKIGFVCRKIIKRLKRCFYIFFYX
>MYB-related_23_4 [tobfac_id=MYB-related_23] [frame=-1]
YKRKYKNTFSTFL*FSYIQTLFFSLPFS*SFSDFKLFNHLFFFFSSFYFLRLYSSEKRPT
WWYRRLMLT*AGCAWYKSLII*NSKLVLVVIFNHSNHLSRSCGQKNCSQSYTCSDKNDGG
GVRKKEVGYVGGTNPRWRCSPAWDTRLERRRFGASFSYHLSLLFHP*GSH*FTLSDILII
NDKYPFICLVWSNLLCF*FNVRST*FFVSLESLFFCRVFFFFLIVLVEIDFVGPLCY*ND
N*LGLVNYY*CLEIDSSFKAL*RSFRISLIL*K*HKNMIS
>MYB-related_23_5 [tobfac_id=MYB-related_23] [frame=-2]
*KKI*KHLFNLFIIFLHTNPIFLPPFLVIFF*FQIIQPSFFLFFFFLFSPVIFIGETAYV
VVPAVDVNVSRVRVVQELDHLEFETCFGGDF*PFKSSEPFMWTKKLFSVVHVFGQKRWWW
GQEKGGGVRGRN*S*VALFSGMGHKIGTSSLRSFVLVPSVLTISPLRFTLIYVK*HSYY*
RQISFYLSCLV*SSLFLI*RT*YLIFRIVRIIVLLSGVFFFFNSFSRNRFRGALMLLK**
LIRISQLLLMFRNRL*F*GTVTVFSHISNFVEVT*KHDKX
>MYB-related_23_6 [tobfac_id=MYB-related_23] [frame=-3]
IKENIKTPFQPFYNFPTYKPYFSPSLSRDLFLISNYSTIFFSFFLLFIFSGYIHRRNGLR
GGTGG*C*REQGARGTRA*SFRIRNLFWW*FLTIQII*AVHVDKKTVLSRTRVRTKTMVV
GSGKRRWGTWEELILGGAVLRHGTQDWNVVASELRSRTICPYYFTPEVHINLR*VTFLLL
TTNILLFVLFGLIFSVFNLTYVVPDFSYR*NHCSSVGCFFFF**F**K*ISWGPYVIKMI
TN*D*STIINV*K*TLVLRHCNGLFAYL*FCRSNIKT**V


Contact:

pr8y@virginia.edu