>MYB-related_28  [length=842] [hit_def=unnamed protein product [Arabidopsis thaliana]] [comment=full length missing first 10 amino acids] [delivery_date=2007-05-03]
AAGCCACAAAATAGTATTTATGTGACATTACAAAATTTTTTTTCATGCAC
AAGTGGAGAAGATTGCAAGTTTGCAACTAAGCATGAATAAACACAATCCT
CTACAGTTTGTCTTTGTACTCTTACATTTCGAAACAACATGTCACCTATG
CGCAGAGGTGCGTTGCATGACATTGTATGGCATGTACGTTGGTGCAGAAA
GATTCACTGGTGTACCAGCGACAGAAACAAAGTGGTCCTGTTACAGGTTG
TTCAATGGTTGTCGCTCCATATAAGCCAACTGCAAAGCCACCAGTTGTTT
GGCCAGTAATTGGAGATTCGGGTACTGAAATATCTCCATTGTGAACTCTA
GTAATGTCATGTATACTTGATCGTCTTCTATCCTTGTTCGTAGAGTTCAA
ATGTACAAAATATTTTGGGCATGACTGGCCACTTGTGTAGGAGTTCTTGT
CACAACAAAGTTTCTAGAAATACTTCGCCAATCACCTTTTCCATATTTTT
CCAAACCAAGAAGGAACAATCTGCATACCAACAAAGATAAAGCAAATGAA
GAAAAAGTCTGTCAATACTAAATTGAAAGATGTTAAACTGTGTCTGGAAT
GCAGAAGATGTCGGTAAGAATATGCATCATCAGTTATTTTCTCCATACTT
ATCACTGCAACCTTGGTTCTTACAGCCAACAAAGTGAATTGCTACAAAAC
AAGATGCAGTTTCAGGAATTTTTAAAACACTTATTTTAGGATGAAAAGGT
GAATCTAAGTCAACCATCATCCTGATTTAGATGCTGGACTTAATGAGTTG
TAATTGCTCCCAAAGGAGACCAACAACACACTTGCCACTGAA


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_28 AAL59913 1.7503e-12 75.485 unknown protein [Arabidopsis thaliana]
MYB-related_28 BAB10001 1.7503e-12 75.485 unnamed protein product [Arabidopsis thaliana]
MYB-related_28 AAS10002 1.7503e-12 75.485 MYB transcription factor [Arabidopsis thaliana]
MYB-related_28 AAM20221 1.7503e-12 75.485 unknown protein [Arabidopsis thaliana]
MYB-related_28 CAE05757 2.98557e-12 74.7146 OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]
MYB-related_28 CAE05757 9.60424e-11 69.707 OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]
MYB-related_28 AAM20221 2.36561e-09 65.0846 unknown protein [Arabidopsis thaliana]
MYB-related_28 AAL59913 2.36561e-09 65.0846 unknown protein [Arabidopsis thaliana]
MYB-related_28 AAS10002 2.36561e-09 65.0846 MYB transcription factor [Arabidopsis thaliana]
MYB-related_28 BAB10001 2.36561e-09 65.0846 unnamed protein product [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET044666

ET044562

ET050625

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_28
>MYB-related_28_1 [tobfac_id=MYB-related_28] [frame=1]
KPQNSIYVTLQNFFSCTSGEDCKFATKHE*TQSSTVCLCTLTFRNNMSPMRRGALHDIVW
HVRWCRKIHWCTSDRNKVVLLQVVQWLSLHISQLQSHQLFGQ*LEIRVLKYLHCEL**CH
VYLIVFYPCS*SSNVQNILGMTGHLCRSSCHNKVSRNTSPITFSIFFQTKKEQSAYQQR*
SK*RKSLSILN*KMLNCVWNAEDVGKNMHHQLFSPYLSLQPWFLQPTK*IATKQDAVSGI
FKTLILG*KGESKSTIILI*MLDLMSCNCSQRRPTTHLPLX
>MYB-related_28_2 [tobfac_id=MYB-related_28] [frame=2]
SHKIVFM*HYKIFFHAQVEKIASLQLSMNKHNPLQFVFVLLHFETTCHLCAEVRCMTLYG
MYVGAERFTGVPATETKWSCYRLFNGCRSI*ANCKATSCLASNWRFGY*NISIVNSSNVM
YT*SSSILVRRVQMYKIFWA*LATCVGVLVTTKFLEILRQSPFPYFSKPRRNNLHTNKDK
ANEEKVCQY*IERC*TVSGMQKMSVRICIISYFLHTYHCNLGSYSQQSELLQNKMQFQEF
LKHLF*DEKVNLSQPSS*FRCWT**VVIAPKGDQQHTCH*X
>MYB-related_28_3 [tobfac_id=MYB-related_28] [frame=3]
ATK*YLCDITKFFFMHKWRRLQVCN*A*INTILYSLSLYSYISKQHVTYAQRCVA*HCMA
CTLVQKDSLVYQRQKQSGPVTGCSMVVAPYKPTAKPPVVWPVIGDSGTEISPL*TLVMSC
ILDRLLSLFVEFKCTKYFGHDWPLV*EFLSQQSF*KYFANHLFHIFPNQEGTICIPTKIK
QMKKKSVNTKLKDVKLCLECRRCR*EYASSVIFSILITATLVLTANKVNCYKTRCSFRNF
*NTYFRMKR*I*VNHHPDLDAGLNEL*LLPKETNNTLATE
>MYB-related_28_4 [tobfac_id=MYB-related_28] [frame=-1]
QWQVCCWSPLGAITTH*VQHLNQDDG*LRFTFSS*NKCFKNS*NCILFCSNSLCWL*EPR
LQ**VWRK*LMMHILTDIFCIPDTV*HLSI*Y*QTFSSFALSLLVCRLFLLGLEKYGKGD
WRSISRNFVVTRTPTQVASHAQNILYI*TLRTRIEDDQVYMTLLEFTMEIFQYPNLQLLA
KQLVALQLAYMERQPLNNL*QDHFVSVAGTPVNLSAPTYMPYNVMQRTSAHR*HVVSKCK
STKTNCRGLCLFMLSCKLAIFSTCA*KKIL*CHINTILWL
>MYB-related_28_5 [tobfac_id=MYB-related_28] [frame=-2]
SVASVLLVSFGSNYNSLSPASKSG*WLT*IHLFILK*VF*KFLKLHLVL*QFTLLAVRTK
VAVISMEKITDDAYSYRHLLHSRHSLTSFNLVLTDFFFICFIFVGMQIVPSWFGKIWKR*
LAKYF*KLCCDKNSYTSGQSCPKYFVHLNSTNKDRRRSSIHDITRVHNGDISVPESPITG
QTTGGFAVGLYGATTIEQPVTGPLCFCRWYTSESFCTNVHAIQCHATHLCA*VTCCFEM*
EYKDKL*RIVFIHA*LQTCNLLHLCMKKNFVMSHKYYFVAX
>MYB-related_28_6 [tobfac_id=MYB-related_28] [frame=-3]
FSGKCVVGLLWEQLQLIKSSI*IRMMVDLDSPFHPKISVLKIPETASCFVAIHFVGCKNQ
GCSDKYGENN**CIFLPTSSAFQTQFNIFQFSIDRLFLHLLYLCWYADCSFLVWKNMEKV
IGEVFLETLL*QELLHKWPVMPKIFCTFELYEQG*KTIKYT*HY*SSQWRYFSTRISNYW
PNNWWLCSWLIWSDNH*TTCNRTTLFLSLVHQ*IFLHQRTCHTMSCNAPLRIGDMLFRNV
RVQRQTVEDCVYSCLVANLQSSPLVHEKKFCNVT*ILFCGX


Contact:

pr8y@virginia.edu