>MYB-related_32  [length=1035] [hit_def=Sequence 2175 from patent US 6833446] [comment=full length] [delivery_date=2007-05-03]
CGATAAGTAAACGAAGAAAAACCGAAATCTGACAAAAACCGACATAAAAC
GAATTAATAAAACCGACCTAATTGATTTGTTTTTTTTATATATAATATTT
TTACCTAGTTAAAGTAATTGAATTTGGACTAATAATTAACGCTGTCAAAA
TATAAAATTACAATAAAATAAGGTGAAAAGAGGAGGCTCCCATAACTGAT
CGAATTTGTCCTCTGGCGGGAGCTTCATAATAGTAGGAAATTACTCATTT
ATTTCTTTGGGAATATCAGATTAACAAAATCTGCTTGCACATTGTTGACG
TTCTGCTTTTATTCCCCTCAGCGGGGTTCCGCCATGGTCGAAAGAGTTTC
TGGATTCTTCTTCGAGAACACGTAAACCAATTCCTCCGATACATATATAG
AAAGAGAAAACGCTCGTAGGTTATAGAAGATTGAGCGTCGGAGAGAAAGA
GAGGGAGATGGGGAACCACAAAGTGAAGTGGACGTCGGAGGAAGAAGGAG
CCCTAAAAGCCGGTGTGGCAAAGCACGGAACCGGAAGGTGGAAGAACATC
CTCAGGGATCCTGAATTCGCGCGCTTTTTGACTAATCGCTCCAACATCGA
TCTCAAGGTTTCTCGTTTTTTTTTTCTTTTTGATGTATATTCATTTGTTT
GTGTGTGGTGTATTCTTTTACTCTTGTTTTGGGTTGATCTTACGCAAAAT
TTATACCTTGAAAGTTGAAATTCAGGACTAGGGTTAATGTGTTTCCCTTG
ATGTTAATGTGTGTTGTTTTATCGTAGTGATTTTTGTCCCGTGTTGTTTT
GGAATATCGAGCATCAGTATAATATTGTTCATATGTCATGAGGCTGCTTC
TAACTGTTGTGGTTTCTGGTCTATTGCATCATAAATGTTGGGCATTGCAA
CTCCTTTATTTGTTTCAACGAGTTAAATATTGCTATATTCATTTTGTAGC
AATGAAAAGATATGGTTGCAACATGTGCGAGGACTTGAAGTAGAGTCATC
AGCCAACTTCCTCTTTGATGGTGCTAATTGCTATA


Pfam accession: Myb_DNA-binding

This gene has been published under the name NtmybB    GenBank AB056124   PMID: 11487700

Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_32 AAW91912 4.71926e-16 87.8113 Sequence 2175 from patent US 6833446
MYB-related_32 AAB61700 5.21776e-15 84.3445 PcMYB1 protein [Petroselinum crispum]
MYB-related_32 AAB61699 5.21776e-15 84.3445 DNA-binding protein PcMYB1 [Petroselinum crispum]
MYB-related_32 AAB61698 5.21776e-15 84.3445 DNA-binding protein PcMYB1 [Petroselinum crispum]
MYB-related_32 AAG51858 5.7689e-14 80.8777 putative DNA-binding protein; 27830-29933 [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET044606

ET042359

ET042358

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_32
>MYB-related_32_1 [tobfac_id=MYB-related_32] [frame=1]
R*VNEEKPKSDKNRHKTN**NRPN*FVFFIYNIFT*LK*LNLD**LTLSKYKITIK*GEK
RRLP*LIEFVLWRELHNSRKLLIYFFGNIRLTKSACTLLTFCFYSPQRGSAMVERVSGFF
FENT*TNSSDTYIERENARRL*KIERRREREGDGEPQSEVDVGGRRSPKSRCGKARNRKV
EEHPQGS*IRALFD*SLQHRSQGFSFFFSF*CIFICLCVVYSFTLVLG*SYAKFIP*KLK
FRTRVNVFPLMLMCVVLS**FLSRVVLEYRASV*YCSYVMRLLLTVVVSGLLHHKCWALQ
LLYLFQRVKYCYIHFVAMKRYGCNMCEDLK*SHQPTSSLMVLIAI
>MYB-related_32_2 [tobfac_id=MYB-related_32] [frame=2]
DK*TKKNRNLTKTDIKRINKTDLIDLFFLYIIFLPS*SN*IWTNN*RCQNIKLQ*NKVKR
GGSHN*SNLSSGGSFIIVGNYSFISLGISD*QNLLAHC*RSAFIPLSGVPPWSKEFLDSS
SRTRKPIPPIHI*KEKTLVGYRRLSVGEKEREMGNHKVKWTSEEEGALKAGVAKHGTGRW
KNILRDPEFARFLTNRSNIDLKVSRFFFLFDVYSFVCVWCILLLLFWVDLTQNLYLES*N
SGLGLMCFP*C*CVLFYRSDFCPVLFWNIEHQYNIVHMS*GCF*LLWFLVYCIINVGHCN
SFICFNELNIAIFIL*Q*KDMVATCART*SRVISQLPL*WC*LLX
>MYB-related_32_3 [tobfac_id=MYB-related_32] [frame=3]
ISKRRKTEI*QKPT*NELIKPT*LICFFYI*YFYLVKVIEFGLIINAVKI*NYNKIR*KE
EAPITDRICPLAGAS***EITHLFLWEYQINKICLHIVDVLLLFPSAGFRHGRKSFWILL
REHVNQFLRYIYRKRKRS*VIED*ASERKRGRWGTTK*SGRRRKKEP*KPVWQSTEPEGG
RTSSGILNSRAF*LIAPTSISRFLVFFFFLMYIHLFVCGVFFYSCFGLILRKIYTLKVEI
QD*G*CVSLDVNVCCFIVVIFVPCCFGISSISIILFICHEAASNCCGFWSIAS*MLGIAT
PLFVSTS*ILLYSFCSNEKIWLQHVRGLEVESSANFLFDGANCYX
>MYB-related_32_4 [tobfac_id=MYB-related_32] [frame=-1]
YSN*HHQRGSWLMTLLQVLAHVATISFHCYKMNIAIFNSLKQIKELQCPTFMMQ*TRNHN
S*KQPHDI*TILY*CSIFQNNTGQKSLR*NNTH*HQGKHINPSPEFQLSRYKFCVRSTQN
KSKRIHHTQTNEYTSKRKKKRETLRSMLERLVKKRANSGSLRMFFHLPVPCFATPAFRAP
SSSDVHFTLWFPISLSFSPTLNLL*PTSVFSFYICIGGIGLRVLEEESRNSFDHGGTPLR
GIKAERQQCASRFC*SDIPKEINE*FPTIMKLPPEDKFDQLWEPPLFTLFYCNFIF*QR*
LLVQIQLL*LGKNIIYKKNKSIRSVLLIRFMSVFVRFRFFFVYLS
>MYB-related_32_5 [tobfac_id=MYB-related_32] [frame=-2]
*QLAPSKRKLADDSTSSPRTCCNHIFSLLQNEYSNI*LVETNKGVAMPNIYDAIDQKPQQ
LEAAS*HMNNIILMLDIPKQHGTKITTIKQHTLTSRETH*P*S*ISTFKV*ILRKINPKQ
E*KNTPHTNK*IYIKKKKKTRNLEIDVGAISQKAREFRIPEDVLPPSGSVLCHTGF*GSF
FLRRPLHFVVPHLPLFLSDAQSSITYERFLFLYMYRRNWFTCSRRRIQKLFRPWRNPAEG
NKSRTSTMCKQILLI*YSQRNK*VISYYYEAPARGQIRSVMGASSFHLILL*FYILTALI
ISPNSITLTR*KYYI*KKQIN*VGFINSFYVGFCQISVFLRLLIX
>MYB-related_32_6 [tobfac_id=MYB-related_32] [frame=-3]
IAISTIKEEVG**LYFKSSHMLQPYLFIATK*I*QYLTR*NK*RSCNAQHL*CNRPETTT
VRSSLMTYEQYYTDARYSKTTRDKNHYDKTTHINIKGNTLTLVLNFNFQGINFA*DQPKT
RVKEYTTHKQMNIHQKEKKNEKP*DRCWSD*SKSARIQDP*GCSSTFRFRALPHRLLGLL
LPPTSTSLCGSPSPSLSLRRSIFYNLRAFSLSIYVSEELVYVFSKKNPETLSTMAEPR*G
E*KQNVNNVQADFVNLIFPKK*MSNFLLL*SSRQRTNSISYGSLLFSPYFIVILYFDSVN
Y*SKFNYFN*VKILYIKKTNQLGRFY*FVLCRFLSDFGFSSFTYR


Contact:

pr8y@virginia.edu