>MYB-related_35  [length=1038] [hit_def=OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]] [comment=missing first 10 amino acids] [delivery_date=2007-05-03]
ATGTACGTTGTGCAGAAAGATTCACTGGTGTATCAATGGCAGAAACAAGT
GGTGCGGTTACAGGTTGTCCAATGGTGGTCGTTCCATATATGCCAACTGC
AAGGGGAGCAACTGGTGCTTCTATGGATCGTTTGTTTGATTTGCCAGAAG
AACCTTGAGGTGCTGAAACATCTCCATTATTAACACTGGTGATGTCATGT
ATACTTGACCGTCTTCTATCCTTGTTCGTAGGGTTCAAACGTATGAAATA
TTTTTTCGCATGACTAATGGCGGAGCCAGAATCTATACAAAGGGGTGTCA
AAATCTAAAGAAGAAGCCAAAAAATAGAAACTATGCTGCAATAGGGAATG
GAACTTACGACCTTCAATCACTTTTGACACCCCTTGACCATTGCTCTAAG
AGATTGTCCTGTGTCAAGGGTCGTCAACCCATTGTATATATTCAATTTTT
TTTTAAAAATACCGATCTACACAGTGTTATTTTCCGGCGAAGGGGTGTCA
GGGTAGCTCCGCCCCTGCGCATGACTGGCCACTTGTGTAGGAGTTCTTGT
CATAACAAAGTTCCGAGAAATACTTCTCCAATCACCTTTTCCATATTTTT
CCAAACCAAGAAGGAACAATCTGCGTACCAACATAGATAAAGAAAATGAA
GAAAAAGTCTGTCAATACTAAATTGAAAGGATGTTAAACTGTGTCTGAAA
TGCAGAATATGCATCATCAATTATTTTCTCCATACTTATATATCACTGCA
ACCTTGGTTGTTATAGCCAACAAAGTGAGAAGTCTAATTGCTACAGAACA
TGATCCAGTTTCAGGAATTTTAAGTACACTTATTTTAGGATGAAAAGATG
AATGTAACAACCTCCAAATATGAACACTCACAATAACAGAAGAAGAAGAT
TGATTGTTTAATTAATTACCAAAATACATAAGGAAAGCTAGAGAAGGATA
GAAGAACAATAACCTAGAAGAAGGGGATGAGAATGCAGAGAACGCAGAAT
AGGGATGGGAGGACTCAGACATTTCATTCCACAATAAA


Pfam accession: Myb_DNA-binding

This gene has been published under the name mybAS2    GenBank AF198498   PMID: 11500571

Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_35 CAE05757 1.4242e-20 102.834 OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]
MYB-related_35 BAB10001 9.88582e-14 80.1073 unnamed protein product [Arabidopsis thaliana]
MYB-related_35 AAM20221 9.88582e-14 80.1073 unknown protein [Arabidopsis thaliana]
MYB-related_35 AAL59913 9.88582e-14 80.1073 unknown protein [Arabidopsis thaliana]
MYB-related_35 AAS10002 9.88582e-14 80.1073 MYB transcription factor [Arabidopsis thaliana]
MYB-related_35 AAL59913 5.42453e-12 74.3294 unknown protein [Arabidopsis thaliana]
MYB-related_35 BAB10001 5.42453e-12 74.3294 unnamed protein product [Arabidopsis thaliana]
MYB-related_35 AAS10002 5.42453e-12 74.3294 MYB transcription factor [Arabidopsis thaliana]
MYB-related_35 AAM20221 5.42453e-12 74.3294 unknown protein [Arabidopsis thaliana]
MYB-related_35 CAE05757 7.08465e-12 73.9442 OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]


Component TGI GSRs via NCBI:

ET044022

ET046459

ET045143

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_35
>MYB-related_35_1 [tobfac_id=MYB-related_35] [frame=1]
MYVVQKDSLVYQWQKQVVRLQVVQWWSFHICQLQGEQLVLLWIVCLICQKNLEVLKHLHY
*HW*CHVYLTVFYPCS*GSNV*NIFSHD*WRSQNLYKGVSKSKEEAKK*KLCCNREWNLR
PSITFDTP*PLL*EIVLCQGSSTHCIYSIFF*KYRSTQCYFPAKGCQGSSAPAHDWPLV*
EFLS*QSSEKYFSNHLFHIFPNQEGTICVPT*IKKMKKKSVNTKLKGC*TVSEMQNMHHQ
LFSPYLYITATLVVIANKVRSLIATEHDPVSGILSTLILG*KDECNNLQI*TLTITEEED
*LFN*LPKYIRKAREG*KNNNLEEGDENAENAE*GWEDSDISFHNK
>MYB-related_35_2 [tobfac_id=MYB-related_35] [frame=2]
CTLCRKIHWCINGRNKWCGYRLSNGGRSIYANCKGSNWCFYGSFV*FARRTLRC*NISII
NTGDVMYT*PSSILVRRVQTYEIFFRMTNGGARIYTKGCQNLKKKPKNRNYAAIGNGTYD
LQSLLTPLDHCSKRLSCVKGRQPIVYIQFFFKNTDLHSVIFRRRGVRVAPPLRMTGHLCR
SSCHNKVPRNTSPITFSIFFQTKKEQSAYQHR*RK*RKSLSILN*KDVKLCLKCRICIIN
YFLHTYISLQPWLL*PTK*EV*LLQNMIQFQEF*VHLF*DEKMNVTTSKYEHSQ*QKKKI
DCLINYQNT*GKLEKDRRTIT*KKGMRMQRTQNRDGRTQTFHSTIX
>MYB-related_35_3 [tobfac_id=MYB-related_35] [frame=3]
VRCAERFTGVSMAETSGAVTGCPMVVVPYMPTARGATGASMDRLFDLPEEP*GAETSPLL
TLVMSCILDRLLSLFVGFKRMKYFFA*LMAEPESIQRGVKI*RRSQKIETMLQ*GMELTT
FNHF*HPLTIALRDCPVSRVVNPLYIFNFFLKIPIYTVLFSGEGVSG*LRPCA*LATCVG
VLVITKFREILLQSPFPYFSKPRRNNLRTNIDKENEEKVCQY*IERMLNCV*NAEYASSI
IFSILIYHCNLGCYSQQSEKSNCYRT*SSFRNFKYTYFRMKR*M*QPPNMNTHNNRRRRL
IV*LITKIHKES*RRIEEQ*PRRRG*ECRERRIGMGGLRHFIPQ*X
>MYB-related_35_4 [tobfac_id=MYB-related_35] [frame=-1]
FIVE*NV*VLPSLFCVLCILIPFF*VIVLLSFSSFPYVFW*LIKQSIFFFCYCECSYLEV
VTFIFSS*NKCT*NS*NWIMFCSN*TSHFVGYNNQGCSDI*VWRK*LMMHILHFRHSLTS
FQFSIDRLFLHFLYLCWYADCSFLVWKNMEKVIGEVFLGTLL*QELLHKWPVMRRGGATL
TPLRRKITLCRSVFLKKN*IYTMG*RPLTQDNLLEQWSRGVKSD*RS*VPFPIAA*FLFF
GFFFRF*HPFV*ILAPPLVMRKNISYV*TLRTRIEDGQVYMTSPVLIMEMFQHLKVLLAN
QTNDP*KHQLLPLQLAYMERPPLDNL*PHHLFLPLIHQ*IFLHNVH
>MYB-related_35_5 [tobfac_id=MYB-related_35] [frame=-2]
YCGMKCLSPPIPILRSLHSHPLLLGYCSSILL*LSLCILVIN*TINLLLLLL*VFIFGGC
YIHLFILK*VYLKFLKLDHVL*QLDFSLCWL*QPRLQ*YISMEKIIDDAYSAFQTQFNIL
SI*Y*QTFSSFSLSMLVRRLFLLGLEKYGKGDWRSISRNFVMTRTPTQVASHAQGRSYPD
TPSPENNTV*IGIFKKKLNIYNGLTTLDTGQSLRAMVKGCQK*LKVVSSIPYCSIVSIFW
LLL*ILTPLCIDSGSAISHAKKYFIRLNPTNKDRRRSSIHDITSVNNGDVSAPQGSSGKS
NKRSIEAPVAPLAVGIYGTTTIGQPVTAPLVSAIDTPVNLSAQRTX
>MYB-related_35_6 [tobfac_id=MYB-related_35] [frame=-3]
LLWNEMSESSHPYSAFSAFSSPSSRLLFFYPSLAFLMYFGN*LNNQSSSSVIVSVHIWRL
LHSSFHPKISVLKIPETGSCSVAIRLLTLLAITTKVAVIYKYGENN**CIFCISDTV*HP
FNLVLTDFFFIFFIYVGTQIVPSWFGKIWKR*LEKYFSELCYDKNSYTSGQSCAGAELP*
HPFAGK*HCVDRYF*KKIEYIQWVDDP*HRTIS*SNGQGVSKVIEGRKFHSLLQHSFYFL
ASSLDFDTPLYRFWLRH*SCEKIFHTFEPYEQG*KTVKYT*HHQC**WRCFSTSRFFWQI
KQTIHRSTSCSPCSWHIWNDHHWTTCNRTTCFCH*YTSESFCTTYX


Contact:

pr8y@virginia.edu