>MYB-related_36  [length=576] [hit_def=I-box binding factor [Lycopersicon esculentum]] [comment=missing 5 prime 5 amino acids] [delivery_date=2007-05-03]
TTCTATGACTGTTATATGACCAAAAATCCTAATATTCTTGCATAGGTTAT
TCCTTATTGGGCTGGAGAAATACGGGAAGGGTGACTGGAGAAGCATTTCA
AGAAACGTAGTGGTAACAAGGACGCCAACACAAGTGGCAAGTCATGCTCA
AAAATACTTCATTAGACAGCAGGCAATGAAGAAAGAACGAAAAAGGTCAA
GCATCCATGATATTACAACTGCAGTGGATACCAACCCAGTACCTCCTCAA
AGCAGCTTTCAAAATCAAAGAGGTAACTTTACCATGTAGAGGTAAAAAGT
AGGAAACAGAACACTCACACCTGTAAATAGAAGGATCGCCAGCTACCAAA
ATTTCGAACTTGTAAAGTTTTATTTTCTCTAGTTGACAGTTGATTTTAGT
TAGTGAATCCAGGAGCTTAAAGAATGGATTTTTTTTTTCGATGCGAGCAG
AATGGGTGTACTTACAGGGAGAACAGTTAATGAAATTGTTGGCAAATGGT
TGAAGAACAGAATGCTGTTCAATTTTTTTATTTTTAATGGTTGGTTGCCT
TAGTTGTGATGATGAGTATATTCCAT


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_36 CAB65169 3.73445e-37 156.377 I-box binding factor [Lycopersicon esculentum]
MYB-related_36 BAB86893 2.27087e-26 120.553 syringolide-induced protein 1-3-1B [Glycine max]
MYB-related_36 BAB86892 6.60722e-26 119.013 syringolide-induced protein 1-3-1A [Glycine max]
MYB-related_36 AAM65901 5.59335e-25 115.931 I-box binding factor-like protein [Arabidopsis thaliana]
MYB-related_36 BAB08980 5.59335e-25 115.931 I-box binding factor-like protein [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET047668

ET047666

ET047667

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_36
>MYB-related_36_1 [tobfac_id=MYB-related_36] [frame=1]
FYDCYMTKNPNILA*VIPYWAGEIREG*LEKHFKKRSGNKDANTSGKSCSKILH*TAGNE
ERTKKVKHP*YYNCSGYQPSTSSKQLSKSKR*LYHVEVKSRKQNTHTCK*KDRQLPKFRT
CKVLFSLVDS*F*LVNPGA*RMDFFFRCEQNGCTYRENS**NCWQMVEEQNAVQFFYF*W
LVALVVMMSIFH
>MYB-related_36_2 [tobfac_id=MYB-related_36] [frame=2]
SMTVI*PKILIFLHRLFLIGLEKYGKGDWRSISRNVVVTRTPTQVASHAQKYFIRQQAMK
KERKRSSIHDITTAVDTNPVPPQSSFQNQRGNFTM*R*KVGNRTLTPVNRRIASYQNFEL
VKFYFL*LTVDFS**IQELKEWIFFFDASRMGVLTGRTVNEIVGKWLKNRMLFNFFIFNG
WLP*L***VYSX
>MYB-related_36_3 [tobfac_id=MYB-related_36] [frame=3]
L*LLYDQKS*YSCIGYSLLGWRNTGRVTGEAFQET*W*QGRQHKWQVMLKNTSLDSRQ*R
KNEKGQASMILQLQWIPTQYLLKAAFKIKEVTLPCRGKK*ETEHSHL*IEGSPATKISNL
*SFIFSS*QLILVSESRSLKNGFFFSMRAEWVYLQGEQLMKLLANG*RTECCSIFLFLMV
GCLSCDDEYIPX
>MYB-related_36_4 [tobfac_id=MYB-related_36] [frame=-1]
MEYTHHHN*GNQPLKIKKLNSILFFNHLPTISLTVLPVSTPILLASKKKIHSLSSWIH*L
KSTVN*RK*NFTSSKFW*LAILLFTGVSVLFPTFYLYMVKLPL*F*KLL*GGTGLVSTAV
VISWMLDLFRSFFIACCLMKYF*A*LATCVGVLVTTTFLEMLLQSPFPYFSSPIRNNLCK
NIRIFGHITVIE
>MYB-related_36_5 [tobfac_id=MYB-related_36] [frame=-2]
GIYSSSQLRQPTIKNKKIEQHSVLQPFANNFINCSPCKYTHSARIEKKNPFFKLLDSLTK
INCQLEKIKLYKFEILVAGDPSIYRCECSVSYFLPLHGKVTSLILKAALRRYWVGIHCSC
NIMDA*PFSFFLHCLLSNEVFLSMTCHLCWRPCYHYVS*NASPVTLPVFLQPNKE*PMQE
Y*DFWSYNSHRX
>MYB-related_36_6 [tobfac_id=MYB-related_36] [frame=-3]
WNILIITTKATNH*K*KN*TAFCSSTICQQFH*LFSL*VHPFCSHRKKKSIL*APGFTN*
NQLSTRENKTLQVRNFGSWRSFYLQV*VFCFLLFTSTW*SYLFDFESCFEEVLGWYPLQL
*YHGCLTFFVLSSLPAV**SIFEHDLPLVLASLLPLRFLKCFSSHPSRISPAQ*GITYAR
ILGFLVI*QS*X


Contact:

pr8y@virginia.edu