>MYB-related_40  [length=754] [hit_def=Single myb histone 4 [Zea mays]] [comment=full length] [delivery_date=2007-05-03]
ATTCTTTTTACAAAAGACAGGTCAAGTACAAAACTTTTCGTCTCCCCGAT
GTTAATTCAGAAGAAAAATGGAAGGAAAAAAGGAAAACCTTAAGATCGAT
GTAGGAGCGAGAGTAAAGGAGGTGATTGAATTCAGGGTCCCTTTGAATGT
TCTTCCATTTGCCAGCTCCGTGCTTTGCGACGCCGGCACGAAGTGCTTCT
TCTTCTTCAGATGTCCATTTCTGCTTTGGATTTCCCATCTCTTTTGCTCA
ATTTTATCTCTTACCAGCTGCAGCTGCTGCTTCTTAAACCCTCCTCTGAA
CTGATCCTCTGTTTGTTTTTTGTTTTTTTTAAAACGGCGTTTACTTCTTC
GGTTGGGATTTTTGCATTTATTGACGTTTTGGCCCCTCAACCATCTATTT
TGCAACTTGGACCTTGTTATTTAAATTGTTTTGGTTTTCCTAACCCAATA
AGTTGGGAATCCGAATTTCTTCAATTTATACATTTGTACTGATATGCTCT
GAATCAAGGGCGGAACTGATTCAATTGAATCTCTTTTGTGAAAAAAAAAT
ATACTATACAAAAAGGTATAAATAATTTTTATGTATATTATTGGCATAAG
GGAAGCTTTACTATAATAATAAAGAAAATTCAAAAATTACTTTAGGTTAT
AGGTTTAAATCTTAAACGTTACATTTTTATAATTTTTAAATACCGTTACT
AAAATATTTTATTTCGTCACTGTTTCAACCTCCACCCACTCCCTCAAGAC
CATT


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_40 AAQ62068 1.07306e-15 85.8853 Single myb histone 4 [Zea mays]
MYB-related_40 AAL73044 1.07306e-15 85.8853 histone H1-like protein [Zea mays]
MYB-related_40 CAD44620 5.32555e-15 83.5741 MYB28 protein [Oryza sativa (japonica cultivar-group)]
MYB-related_40 AAQ62066 9.08401e-15 82.8037 single myb histone 3 [Zea mays]
MYB-related_40 AAW91912 5.88808e-14 80.1073 Sequence 2175 from patent US 6833446


Component TGI GSRs via NCBI:

ET050165

ET041965

ET046943

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_40
>MYB-related_40_1 [tobfac_id=MYB-related_40] [frame=1]
ILFTKDRSSTKLFVSPMLIQKKNGRKKGKP*DRCRSESKGGD*IQGPFECSSICQLRALR
RRHEVLLLLQMSISALDFPSLLLNFISYQLQLLLLKPSSELILCLFFVFFKTAFTSSVGI
FAFIDVLAPQPSILQLGPCYLNCFGFPNPISWESEFLQFIHLY*YALNQGRN*FN*ISFV
KKKYTIQKGINNFYVYYWHKGSFTIIIKKIQKLL*VIGLNLKRYIFIIFKYRY*NILFRH
CFNLHPLPQDHX
>MYB-related_40_2 [tobfac_id=MYB-related_40] [frame=2]
FFLQKTGQVQNFSSPRC*FRRKMEGKKENLKIDVGARVKEVIEFRVPLNVLPFASSVLCD
AGTKCFFFFRCPFLLWISHLFCSILSLTSCSCCFLNPPLN*SSVCFLFFLKRRLLLRLGF
LHLLTFWPLNHLFCNLDLVI*IVLVFLTQ*VGNPNFFNLYICTDML*IKGGTDSIESLL*
KKNILYKKV*IIFMYIIGIREALL***RKFKNYFRL*V*ILNVTFL*FLNTVTKIFYFVT
VSTSTHSLKTI
>MYB-related_40_3 [tobfac_id=MYB-related_40] [frame=3]
SFYKRQVKYKTFRLPDVNSEEKWKEKRKTLRSM*ERE*RR*LNSGSL*MFFHLPAPCFAT
PARSASSSSDVHFCFGFPISFAQFYLLPAAAAAS*TLL*TDPLFVFCFF*NGVYFFGWDF
CIY*RFGPSTIYFATWTLLFKLFWFS*PNKLGIRISSIYTFVLICSESRAELIQLNLFCE
KKIYYTKRYK*FLCILLA*GKLYYNNKENSKITLGYRFKS*TLHFYNF*IPLLKYFISSL
FQPPPTPSRPX
>MYB-related_40_4 [tobfac_id=MYB-related_40] [frame=-1]
MVLREWVEVETVTK*NILVTVFKNYKNVTFKI*TYNLK*FLNFLYYYSKASLMPIIYIKI
IYTFLYSIFFFHKRDSIESVPPLIQSISVQMYKLKKFGFPTYWVRKTKTI*ITRSKLQNR
WLRGQNVNKCKNPNRRSKRRFKKNKKQTEDQFRGGFKKQQLQLVRDKIEQKRWEIQSRNG
HLKKKKHFVPASQSTELANGRTFKGTLNSITSFTLAPTSILRFSFFPSIFLLN*HRGDEK
FCT*PVFCKKN
>MYB-related_40_5 [tobfac_id=MYB-related_40] [frame=-2]
NGLEGVGGG*NSDEIKYFSNGI*KL*KCNV*DLNL*PKVIFEFSLLL**SFPYANNIHKN
YLYLFV*YIFFSQKRFN*ISSALDSEHISTNV*IEEIRIPNLLG*ENQNNLNNKVQVAK*
MVEGPKRQ*MQKSQPKK*TPF*KKQKTNRGSVQRRV*EAAAAAGKR*N*AKEMGNPKQKW
TSEEEEALRAGVAKHGAGKWKNIQRDPEFNHLLYSRSYIDLKVFLFSFHFSSELTSGRRK
VLYLTCLL*KEX
>MYB-related_40_6 [tobfac_id=MYB-related_40] [frame=-3]
WS*GSGWRLKQ*RNKIF**RYLKIIKM*RLRFKPIT*SNF*IFFIIIVKLPLCQ*YT*KL
FIPFCIVYFFFTKEIQLNQFRP*FRAYQYKCIN*RNSDSQLIGLGKPKQFK*QGPSCKID
G*GAKTSINAKIPTEEVNAVLKKTKNKQRISSEEGLRSSSCSW*EIKLSKRDGKSKAEMD
I*RRRSTSCRRRKARSWQMEEHSKGP*IQSPPLLSLLHRS*GFPFFLPFFF*INIGETKS
FVLDLSFVKRX


Contact:

pr8y@virginia.edu