>MYB-related_57  [length=1504] [hit_def=] [comment=full length but missing last 9 amino acids] [delivery_date=2007-05-03]
CGTTTGAAACCATGAACTCAAACTCTCCTTTCATGGCTAACAACAATTCA
ACGCCTACCGACTCTTCTGGCAAAAAGGTTCGGAAACCTTACACCATAAC
TAAGTCTAGAGAAAGCTGGACTGAAGAAGAACACGACAAGTTCCTTGAAG
CTCTTCAACTGTTATGTCTCTTCTCCCTTTTTCAGCTGTTTTAATTGTGA
ACAAATGTGTTTTTTTATACATGTAATTGAGTTAGTTGTTGGTTTCTGAA
TTTTATATACACTTGTAACAATTTTGTAAAATAAACTACTTATTCTAAGA
TATAGTGCTCATTGTAATGAAATATTAATGGATGCAGCGGTACTCTGCAT
CTATTAGTAATTTATAATTTTGGATCAGTGTCTATGTTCCTTCCTTGAGC
CGAGTTTCTATCAGAAATAACTTTTCTACCTTCTCACCGTAGGGTTAAGG
ACCTCACGGTAGGGGTAAGTACTACCTACACACTACTTTCCCTGGACTCC
AATCGTGGGATTACGCTGAATTTGTTATTGTTGTTAGTATTATTGTTGGA
TCAGTCTCTATGTTGGCAGTAGCAGAGGTTTGTGCTCAATTGAAGATTTT
CCTGGGTAGATGTTTGGATGTTATTCCGGTGTTGCAAAAAGCTTAACTTG
TTAGAAAGAGCACATTTTTATTTATTTAATTTTGTCCTCAACATGAGCCA
AGTAATTTTTTCATCTTTTTTCTTTTCTTTTCTGCTATACGGGTAGAAAC
TAGAAAGCCGTATAATTGATTTATTCTAGTATTGGTTTTGAATTTTATTT
TGGAAGTTCCATTTTTGTAGTACTAATTTGGATTTTTTATGGTCAGTTAG
CTCCTTTGTGTTGCCTTTGTGACATGTGTGTTCTGAATCTTAAAGCTGCA
TTAGAAAAAAAATGTTTTTTTCTGAAGCTTTGGTGTTTCTTCTAAATTTG
GGTTATTCAGGTTTGACCGTGATTGGAAGAAAATTGAGGATTTTGTAGGC
TCAAAGACAGTAATTCAGGTGCTCACTTCTGTTTCATCTTTTTGATGAAG
TTCATAGAGAAAACTAGTTAGTTTTATTCTGTTTGTATATATTTGTTCTG
CTGAGAAATCGTGGTGGAATATGCTGTATTTCTCCAATTAATTATTTGTA
GTAATTTTCTGTGATTGACTTATTCCTAATCATGTACACGCCGGACGAGT
ACCAATTCTCTTTGGATCTGCTATCATGAAAATGCTAGTCAGGCTTTTGA
ATATACTTAATGTGTATTGTATGATGCCTGGTGCATTTGCAACCTTTCGC
TTTTGGAGTTAATTCTTGGTGTATGACATGCGTTCGCAGGTACCTGGTGT
AAAATGTAGGGCTGGCTTAATTTAATCCTGTTTAGATCCTCTATTCCATG
GGAATTTATTTGAGCATGTGCTAATGTGCGAAAATTAAGTACTATTTTTT
TAGGCCCTTTCTTTTGGTCGAATTTAGAGAATTTTTCACAAATCTTTTTT
TTTT


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition


Component TGI GSRs via NCBI:

ET042871

ET042870

ET042872

ET041883

ET042529

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_57
>MYB-related_57_1 [tobfac_id=MYB-related_57] [frame=1]
RLKP*TQTLLSWLTTIQRLPTLLAKRFGNLTP*LSLEKAGLKKNTTSSLKLFNCYVSSPF
FSCFNCEQMCFFIHVIELVVGF*ILYTLVTIL*NKLLILRYSAHCNEILMDAAVLCIY**
FIILDQCLCSFLEPSFYQK*LFYLLTVGLRTSR*G*VLPTHYFPWTPIVGLR*ICYCC*Y
YCWISLYVGSSRGLCSIEDFPG*MFGCYSGVAKSLTC*KEHIFIYLILSST*AK*FFHLF
SFLFCYTGRN*KAV*LIYSSIGFEFYFGSSIFVVLIWIFYGQLAPLCCLCDMCVLNLKAA
LEKKCFFLKLWCFF*IWVIQV*P*LEEN*GFCRLKDSNSGAHFCFIFLMKFIEKTS*FYS
VCIYLFC*EIVVEYAVFLQLIICSNFL*LTYS*SCTRRTSTNSLWICYHENASQAFEYT*
CVLYDAWCICNLSLLELILGV*HAFAGTWCKM*GWLNLILFRSSIPWEFI*ACANVRKLS
TIFLGPFFWSNLENFSQIFFFX
>MYB-related_57_2 [tobfac_id=MYB-related_57] [frame=2]
V*NHELKLSFHG*QQFNAYRLFWQKGSETLHHN*V*RKLD*RRTRQVP*SSSTVMSLLPF
SAVLIVNKCVFLYM*LS*LLVSEFYIHL*QFCKINYLF*DIVLIVMKY*WMQRYSASISN
L*FWISVYVPSLSRVSIRNNFSTFSP*G*GPHGRGKYYLHTTFPGLQSWDYAEFVIVVSI
IVGSVSMLAVAEVCAQLKIFLGRCLDVIPVLQKA*LVRKSTFLFI*FCPQHEPSNFFIFF
LFFSAIRVETRKPYN*FILVLVLNFILEVPFL*Y*FGFFMVS*LLCVAFVTCVF*ILKLH
*KKNVFF*SFGVSSKFGLFRFDRDWKKIEDFVGSKTVIQVLTSVSSF**SS*RKLVSFIL
FVYICSAEKSWWNMLYFSN*LFVVIFCD*LIPNHVHAGRVPILFGSAIMKMLVRLLNILN
VYCMMPGAFATFRFWS*FLVYDMRSQVPGVKCRAGLI*SCLDPLFHGNLFEHVLMCEN*V
LFF*ALSFGRI*RIFHKSFFF
>MYB-related_57_3 [tobfac_id=MYB-related_57] [frame=3]
FETMNSNSPFMANNNSTPTDSSGKKVRKPYTITKSRESWTEEEHDKFLEALQLLCLFSLF
QLF*L*TNVFFYTCN*VSCWFLNFIYTCNNFVK*TTYSKI*CSL**NINGCSGTLHLLVI
YNFGSVSMFLP*AEFLSEITFLPSHRRVKDLTVGVSTTYTLLSLDSNRGITLNLLLLLVL
LLDQSLCWQ*QRFVLN*RFSWVDVWMLFRCCKKLNLLERAHFYLFNFVLNMSQVIFSSFF
FSFLLYG*KLESRIIDLF*YWF*ILFWKFHFCSTNLDFLWSVSSFVLPL*HVCSES*SCI
RKKMFFSEALVFLLNLGYSGLTVIGRKLRIL*AQRQ*FRCSLLFHLFDEVHREN*LVLFC
LYIFVLLRNRGGICCISPINYL**FSVIDLFLIMYTPDEYQFSLDLLS*KC*SGF*IYLM
CIV*CLVHLQPFAFGVNSWCMTCVRRYLV*NVGLA*FNPV*ILYSMGIYLSMC*CAKIKY
YFFRPFLLVEFREFFTNLFFX
>MYB-related_57_4 [tobfac_id=MYB-related_57] [frame=-1]
KKKDL*KIL*IRPKERA*KNST*FSHISTCSNKFPWNRGSKQD*IKPALHFTPGTCERMS
YTKN*LQKRKVANAPGIIQYTLSIFKSLTSIFMIADPKRIGTRPACT*LGISQSQKITTN
N*LEKYSIFHHDFSAEQIYTNRIKLTSFLYELHQKDETEVST*ITVFEPTKSSIFFQSRS
NLNNPNLEETPKLQKKTFFF*CSFKIQNTHVTKATQRS*LTIKNPN*YYKNGTSKIKFKT
NTRINQLYGFLVSTRIAEKKRKKMKKLLGSC*GQN*INKNVLFLTS*AFCNTGITSKHLP
RKIFN*AQTSATANIETDPTIILTTITNSA*SHDWSPGKVVCR*YLPLP*GP*PYGEKVE
KLFLIETRLKEGT*TLIQNYKLLIDAEYRCIH*YFITMSTIS*NK*FILQNCYKCI*NSE
TNN*LNYMYKKTHLFTIKTAEKGRRDITVEELQGTCRVLLQSSFL*T*LWCKVSEPFCQK
SR*ALNCC*P*KESLSSWFQT
>MYB-related_57_5 [tobfac_id=MYB-related_57] [frame=-2]
KKKRFVKNSLNSTKRKGLKK*YLIFAH*HMLK*IPME*RI*TGLN*ASPTFYTRYLRTHV
IHQELTPKAKGCKCTRHHTIHIKYIQKPD*HFHDSRSKENWYSSGVYMIRNKSITENYYK
*LIGEIQHIPPRFLSRTNIYKQNKTN*FSL*TSSKR*NRSEHLNYCL*AYKILNFLPITV
KPE*PKFRRNTKASEKNIFFLMQL*DSEHTCHKGNTKELTDHKKSKLVLQKWNFQNKIQN
QY*NKSIIRLSSFYPYSRKEKKKDEKITWLMLRTKLNK*KCALSNKLSFLQHRNNIQTST
QENLQLSTNLCYCQHRD*SNNNTNNNNKFSVIPRLESRESSV*VVLTPTVRSLTLR*EGR
KVISDRNSAQGRNIDTDPKL*ITNRCRVPLHPLIFHYNEHYILE*VVYFTKLLQVYIKFR
NQQLTQLHV*KNTFVHN*NS*KREKRHNS*RASRNLSCSSSVQLSLDLVMV*GFRTFLPE
ESVGVELLLAMKGEFEFMVSNX
>MYB-related_57_6 [tobfac_id=MYB-related_57] [frame=-3]
KKKICEKFSKFDQKKGPKKIVLNFRTLAHAQINSHGIEDLNRIKLSQPYILHQVPANACH
TPRINSKSERLQMHQASYNTH*VYSKA*LAFS**QIQRELVLVRRVHD*E*VNHRKLLQI
INWRNTAYSTTISQQNKYIQTE*N*LVFSMNFIKKMKQK*APELLSLSLQNPQFSSNHGQ
T*ITQI*KKHQSFRKKHFFSNAALRFRTHMSQRQHKGAN*P*KIQISTTKMELPK*NSKP
ILE*INYTAF*FLPV*QKRKEKR*KNYLAHVEDKIK*IKMCSF*QVKLFATPE*HPNIYP
GKSSIEHKPLLLPT*RLIQQ*Y*QQ*QIQRNPTIGVQGK*CVGSTYPYREVLNPTVRR*K
SYF**KLGSRKEHRH*SKIINY**MQSTAASINISLQ*ALYLRISSLFYKIVTSVYKIQK
PTTNSITCIKKHICSQLKQLKKGEET*QLKSFKELVVFFFSPAFSRLSYGVRFPNLFARR
VGRR*IVVSHERRV*VHGFKR


Contact:

pr8y@virginia.edu