>MYB-related_58  [length=1013] [hit_def=putative DNA binding protein [Lycopersicon esculentum]] [comment=Full length] [delivery_date=2007-05-03]
GGGCTTCACGGATTTGTTCAGTCCTATCATTAAGTTATTTGTCGAGCTTT
CACAGTTTCCAGATAACTTTGCCTGCTCGAATGCTGACATTGGAAACTTT
TCTATGGTGTTTTGATTCATTTGCTTATCTTCCAATTTAGCAACAGTTTG
AACCTGCAAAAGAAAGAAGAAAATTTTGGAATCCAAGAACCACAACTTGT
ATGTCTATAAACGACTTAGTACTTCGCGTACAATTGGTTCAGTTGAACCT
ATTGCTTTTTTATTCTTCAGACCATATTAAAATGTAACAAATTGATGAAG
GAATTCTCAAGGCTTACAGTATGAGTGGTGATGTCAAAAAGACTAGAGCG
GCGGCGTCGGCGGTTATTCGTGTTATTTCGGCGGAGAAAGTACTTCTGAG
CATGACTGGCCACCTGAGTAGGGGTCCTTGTCTTGACAAAGTTTCTTGAA
ATTCCTCTCCAATCACCTTTCCCTACTTTCTGCAATCCTAATAAAAATAG
TTTGTGCTCTTCCTCTGTCCATGGAACTCCTATATAATAAGCACCATCCA
TTTAATTAATCCAAAGAGATAAACATGAATCCAAGATTTTAATAACATAG
GCAGATTCAGAATTTTAAAATCATGGATGCACAATCTAGTATCTATACAT
ACATACATATCTTTGAAAATAATTAATCTTGGTAAAATGATATATATATA
TATATATATATATAGACCTCGTTTACGTTCACGGCTCCTAGCAGAAGGAT
GAACAACGTCATCAGAAGCATAGCCGGCGGCGACGTTGGAATCTTGTTGT
TGCTGTTCAAATAGAACAAGGTTGTTCATGCTAGCACTTTTCCTAAAACA
AGTTCCACCTTCTATCACTCTAACACCAAAGAGCATGAACCCTTTGCTTT
GAAGTTCATGCTCTTTGTTTCCGCAATCGTTAGACATTACTATGTGTTTT
TGAGAAAAAAATGAAGGATTATTTATTTTGTGCAGACCATATGAAAGGGA
AGAAATGAGGAAA


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_58 AAX95766 1.56579e-24 115.931 putative DNA binding protein [Lycopersicon esculentum]
MYB-related_58 ABB86258 1.56579e-24 115.931 putative DNA binding protein-like [Solanum tuberosum]
MYB-related_58 AAO45179 1.01491e-23 113.235 transcription factor Myb1 [Malus xiaojinensis]
MYB-related_58 AAD55292 1.91405e-22 108.997 Contains PF|00249 Myb-like DNA-binding domain. EST gb|Z18152 comes from this gene. [Arabidopsis thaliana]
MYB-related_58 AAG51937 1.91405e-22 108.997 putative MYB family transcription factor; 86049-87165 [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET044545

ET051585

ET048828

ET043530

ET043664

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_58
>MYB-related_58_1 [tobfac_id=MYB-related_58] [frame=1]
GLHGFVQSYH*VICRAFTVSR*LCLLEC*HWKLFYGVLIHLLIFQFSNSLNLQKKEENFG
IQEPQLVCL*TT*YFAYNWFS*TYCFFILQTILKCNKLMKEFSRLTV*VVMSKRLERRRR
RLFVLFRRRKYF*A*LAT*VGVLVLTKFLEIPLQSPFPTFCNPNKNSLCSSSVHGTPI**
APSI*LIQRDKHESKILIT*ADSEF*NHGCTI*YLYIHTYL*K*LILVK*YIYIYIYIDL
VYVHGS*QKDEQRHQKHSRRRRWNLVVAVQIEQGCSC*HFS*NKFHLLSL*HQRA*TLCF
EVHALCFRNR*TLLCVFEKKMKDYLFCADHMKGKK*GX
>MYB-related_58_2 [tobfac_id=MYB-related_58] [frame=2]
GFTDLFSPIIKLFVELSQFPDNFACSNADIGNFSMVF*FICLSSNLATV*TCKRKKKILE
SKNHNLYVYKRLSTSRTIGSVEPIAFLFFRPY*NVTN**RNSQGLQYEW*CQKD*SGGVG
GYSCYFGGESTSEHDWPPE*GSLS*QSFLKFLSNHLSLLSAILIKIVCALPLSMELLYNK
HHPFN*SKEINMNPRF**HRQIQNFKIMDAQSSIYTYIHIFENN*SW*NDIYIYIYI*TS
FTFTAPSRRMNNVIRSIAGGDVGILLLLFK*NKVVHASTFPKTSSTFYHSNTKEHEPFAL
KFMLFVSAIVRHYYVFLRKK*RIIYFVQTI*KGRNEEX
>MYB-related_58_3 [tobfac_id=MYB-related_58] [frame=3]
ASRICSVLSLSYLSSFHSFQITLPARMLTLETFLWCFDSFAYLPI*QQFEPAKERRKFWN
PRTTTCMSINDLVLRVQLVQLNLLLFYSSDHIKM*QIDEGILKAYSMSGDVKKTRAAASA
VIRVISAEKVLLSMTGHLSRGPCLDKVS*NSSPITFPYFLQS**K*FVLFLCPWNSYIIS
TIHLINPKR*T*IQDFNNIGRFRILKSWMHNLVSIHTYISLKIINLGKMIYIYIYIYRPR
LRSRLLAEG*TTSSEA*PAATLESCCCCSNRTRLFMLALFLKQVPPSITLTPKSMNPLL*
SSCSLFPQSLDITMCF*EKNEGLFILCRPYEREEMRK
>MYB-related_58_4 [tobfac_id=MYB-related_58] [frame=-1]
SSFLPFHMVCTK*IILHFFLKNT**CLTIAETKSMNFKAKGSCSLVLE**KVELVLGKVL
A*TTLFYLNSNNKIPTSPPAMLLMTLFILLLGAVNVNEVYIYIYIYISFYQD*LFSKICM
YV*ILDCASMILKF*ICLCY*NLGFMFISLD*LNGWCLLYRSSMDRGRAQTIFIRIAESR
ER*LERNFKKLCQDKDPYSGGQSCSEVLSPPK*HE*PPTPPL*SF*HHHSYCKP*EFLHQ
FVTF*YGLKNKKAIGSTEPIVREVLSRL*TYKLWFLDSKIFFFLLQVQTVAKLEDKQMNQ
NTIEKFPMSAFEQAKLSGNCESSTNNLMIGLNKSVKP
>MYB-related_58_5 [tobfac_id=MYB-related_58] [frame=-2]
FLISSLSYGLHKINNPSFFSQKHIVMSNDCGNKEHELQSKGFMLFGVRVIEGGTCFRKSA
SMNNLVLFEQQQQDSNVAAGYASDDVVHPSARSRERKRGLYIYIYIYIILPRLIIFKDMY
VCIDTRLCIHDFKILNLPMLLKSWIHVYLFGLIKWMVLII*EFHGQRKSTNYFY*DCRK*
GKVIGEEFQETLSRQGPLLRWPVMLRSTFSAEITRITADAAALVFLTSPLIL*ALRIPSS
ICYILIWSEE*KSNRFN*TNCTRSTKSFIDIQVVVLGFQNFLLSFAGSNCC*IGR*ANES
KHHRKVSNVSIRAGKVIWKL*KLDK*LNDRTEQIREAX
>MYB-related_58_6 [tobfac_id=MYB-related_58] [frame=-3]
FPHFFPFIWSAQNK*SFIFFSKTHSNV*RLRKQRA*TSKQRVHALWC*SDRRWNLF*EKC
*HEQPCSI*TATTRFQRRRRLCF**RCSSFC*EP*T*TRSIYIYIYIYHFTKINYFQRYV
CMYRY*IVHP*F*NSESAYVIKILDSCLSLWIN*MDGAYYIGVPWTEEEHKLFLLGLQKV
GKGDWRGISRNFVKTRTPTQVASHAQKYFLRRNNTNNRRRRRSSLFDITTHTVSLENSFI
NLLHFNMV*RIKKQ*VQLNQLYAKY*VVYRHTSCGSWIPKFSSFFCRFKLLLNWKISK*I
KTP*KSFQCQHSSRQSYLETVKARQIT***D*TNP*SP


Contact:

pr8y@virginia.edu