>MYB-related_63  [length=1297] [hit_def=unnamed protein product [Arabidopsis thaliana]] [comment=full length] [delivery_date=2007-05-03]
TAGTCATCGGTGAAAGTGGGGGCCTTGCACAAGGAGCAGCCTGCACATAT
ATTATTGTTACGACTATGACTTTAACTTATAGTATTATATAATTAAAAAA
ATAACCTTTATTTTAGTCATTCTAGATAATTTAATCCATATGAACTACAG
TTTATCTGTATCAATTAGATCTGCAGTTTAATAATGTACGTACCTGTCCT
TTAATTTGGCAAGTGTCGAACAGTTGTTCCAATGGGGCACTCGCCTGTCC
AATAAACATAGCCATTTTAATTAATACGCTAATCATATGTAACATTAATT
ATTTTTTGTGGCATCGAAATTATAGACTTGCCTCTTTTTGGACTTCAGGA
ACCATGTTTTTTGAAATAGAAGGTGAAGAAGAATAAGTTTCAGAAGGAAT
CTGTGAAATCTGCAAATTTACAAATTCCTATCAGTATAATACATAGAACA
GAAAAGAAAGCAAAAAAGGAGAATATAATTAAAATATTACCGAATCTTTT
AGATTGACATCAAAGACACTAGGACGACGTTTTTTTTTATCATTTGAGGC
GATTCTGATAAAATACTTTTGGGCATGGCTAGCCACCTGAGATGGAGTCC
TTGTAGGCACATAACTTTTGGAAATTCCTCTCCAATCACCTTTTCCAAGC
TTTTCTAAACCAATTAAGAAAGATCTGTGTTCTTCCTCTGTCCATGATGT
TCCTATCAGAAAATAAAATTACAACTATAATAATTCTGGCTTATACAAAT
GCGATCTAAGCAAGACGCCTTGAAATTCCATTCGGTAGGGAAGGAGGAAT
TTCCTTATACTATATATGTAAAGTAACTCAAACCTTGTATTGAATAATCC
TGGCAAAAAGAAAAAGAGTCTCATATATAGATTTGAAACAAGGATTTTGA
GACAAAATTTTTGAAAACTAGAAACGAACCTAAATCGTAAAAGACTATTG
TAGAATTGATTCAAAACCTCAAAAATCGCTTTAAATACATTGTGATTATT
TCGCTATGAAATAAATAAAACACGCTACAAACCTATATAGTATTGTTATG
ATCTCAAGAAAAAAGACGTGCATGATTCGTGATTGACACCATAAGAAAAC
AATACAAAAACAATACAAAGAATCTATTTTATGAAGGTTCGGCAAGGCGA
CACTAGCCAAAATATCACATTAACATATATAGTAGATGTTTGAACTCTCC
CAAACATAACATTCGACTTAGACACCAATTGGTATATAAAAAAATATAGG
ATAAAGAAATGGTGATCAAGATTTGACAAACCTTTTTTTCTATTTCT


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_63 BAB09006 5.85784e-25 117.857 unnamed protein product [Arabidopsis thaliana]
MYB-related_63 AAW91867 3.2143e-23 112.079 Sequence 2130 from patent US 6833446
MYB-related_63 AAZ20443 3.55383e-22 108.612 MYBR2 [Malus x domestica]
MYB-related_63 CAC24845 6.06191e-22 107.842 MCB2 protein [Hordeum vulgare subsp. vulgare]
MYB-related_63 AAM60886 6.06191e-22 107.842 Myb-related transcription activator-like [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET044948

ET044773

ET046951

ET043486

ET048284

ET047789

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_63
>MYB-related_63_1 [tobfac_id=MYB-related_63] [frame=1]
*SSVKVGALHKEQPAHILLLRL*L*LIVLYN*KNNLYFSHSR*FNPYELQFICIN*ICSL
IMYVPVL*FGKCRTVVPMGHSPVQ*T*PF*LIR*SYVTLIIFCGIEIIDLPLFGLQEPCF
LK*KVKKNKFQKESVKSANLQIPISIIHRTEKKAKKENIIKILPNLLD*HQRH*DDVFFY
HLRRF**NTFGHG*PPEMESL*AHNFWKFLSNHLFQAFLNQLRKICVLPLSMMFLSENKI
TTIIILAYTNAI*ARRLEIPFGREGGISLYYICKVTQTLY*IILAKRKRVSYIDLKQGF*
DKIFEN*KRT*IVKDYCRIDSKPQKSL*IHCDYFAMK*IKHATNLYSIVMISRKKTCMIR
D*HHKKTIQKQYKESIL*RFGKATLAKISH*HI**MFELSQT*HST*TPIGI*KNIG*RN
GDQDLTNLFFYFX
>MYB-related_63_2 [tobfac_id=MYB-related_63] [frame=2]
SHR*KWGPCTRSSLHIYYCYDYDFNL*YYIIKKITFILVILDNLIHMNYSLSVSIRSAV*
*CTYLSFNLASVEQLFQWGTRLSNKHSHFN*YANHM*H*LFFVASKL*TCLFLDFRNHVF
*NRR*RRISFRRNL*NLQIYKFLSV*YIEQKRKQKRRI*LKYYRIF*IDIKDTRTTFFFI
I*GDSDKILLGMASHLRWSPCRHITFGNSSPITFSKLF*TN*ERSVFFLCP*CSYQKIKL
QL**FWLIQMRSKQDALKFHSVGKEEFPYTIYVK*LKPCIE*SWQKEKESHI*I*NKDFE
TKFLKTRNEPKS*KTIVELIQNLKNRFKYIVIISL*NK*NTLQTYIVLL*SQEKRRA*FV
IDTIRKQYKNNTKNLFYEGSARRH*PKYHINIYSRCLNSPKHNIRLRHQLVYKKI*DKEM
VIKI*QTFFSIS
>MYB-related_63_3 [tobfac_id=MYB-related_63] [frame=3]
VIGESGGLAQGAACTYIIVTTMTLTYSII*LKK*PLF*SF*II*SI*TTVYLYQLDLQFN
NVRTCPLIWQVSNSCSNGALACPINIAILINTLIICNINYFLWHRNYRLASFWTSGTMFF
EIEGEEE*VSEGICEICKFTNSYQYNT*NRKESKKGEYN*NITESFRLTSKTLGRRFFLS
FEAILIKYFWAWLAT*DGVLVGT*LLEIPLQSPFPSFSKPIKKDLCSSSVHDVPIRK*NY
NYNNSGLYKCDLSKTP*NSIR*GRRNFLILYM*SNSNLVLNNPGKKKKSLIYRFETRILR
QNF*KLETNLNRKRLL*N*FKTSKIALNTL*LFRYEINKTRYKPI*YCYDLKKKDVHDS*
LTP*ENNTKTIQRIYFMKVRQGDTSQNITLTYIVDV*TLPNITFDLDTNWYIKKYRIKKW
*SRFDKPFFLFL
>MYB-related_63_4 [tobfac_id=MYB-related_63] [frame=-1]
EIEKKVCQILITISLSYIFLYTNWCLSRMLCLGEFKHLLYMLM*YFG*CRLAEPS*NRFF
VLFLYCFLMVSITNHARLFS*DHNNTI*VCSVFYLFHSEIITMYLKRFLRF*INSTIVFY
DLGSFLVFKNFVSKSLFQIYI*DSFSFCQDYSIQGLSYFTYIV*GNSSFPTEWNFKASCL
DRICISQNYYSCNFIF**EHHGQRKNTDLS*LV*KSLEKVIGEEFPKVMCLQGLHLRWLA
MPKSILSESPQMIKKNVVLVSLMSI*KIR*YFNYILLFCFLFCSMYYTDRNL*ICRFHRF
LLKLILLHLLFQKTWFLKSKKRQVYNFDATKNN*CYI*LAY*LKWLCLLDRRVPHWNNCS
TLAKLKDRYVHY*TADLIDTDKL*FIWIKLSRMTKIKVIFLII*YYKLKS*S*Q*YMCRL
LLVQGPHFHR*L
>MYB-related_63_5 [tobfac_id=MYB-related_63] [frame=-2]
RNRKKGLSNLDHHFFILYFFIYQLVSKSNVMFGRVQTSTIYVNVIFWLVSPCRTFIK*IL
CIVFVLFSYGVNHESCTSFFLRS*QYYIGL*RVLFIS*RNNHNVFKAIFEVLNQFYNSLL
RFRFVSSFQKFCLKILVSNLYMRLFFFLPGLFNTRFELLYIYSIRKFLLPYRMEFQGVLL
RSHLYKPELL*L*FYFLIGTSWTEEEHRSFLIGLEKLGKGDWRGISKSYVPTRTPSQVAS
HAQKYFIRIASNDKKKRRPSVFDVNLKDSVIF*LYSPFLLSFLFYVLY**EFVNLQISQI
PSETYSSSPSISKNMVPEVQKEASL*FRCHKK*LMLHMISVLIKMAMFIGQASAPLEQLF
DTCQIKGQVRTLLNCRSN*YR*TVVHMD*II*ND*NKGYFFNYIIL*VKVIVVTIIYVQA
APCARPPLSPMTX
>MYB-related_63_6 [tobfac_id=MYB-related_63] [frame=-3]
K*KKRFVKS*SPFLYPIFFYIPIGV*VECYVWESSNIYYIC*CDILASVALPNLHKIDSL
YCFCIVFLWCQSRIMHVFFLEIITILYRFVACFIYFIAK*SQCI*SDF*GFESILQ*SFT
I*VRF*FSKILSQNPCFKSIYETLFLFARIIQYKV*VTLHI*YKEIPPSLPNGISRRLA*
IAFV*ARIIIVVILFSDRNIMDRGRTQIFLNWFRKAWKR*LERNFQKLCAYKDSISGG*P
CPKVFYQNRLK**KKTSS*CL*CQSKRFGNILIIFSFFAFFSVLCIILIGICKFADFTDS
F*NLFFFTFYFKKHGS*SPKRGKSIISMPQKIINVTYD*RIN*NGYVYWTGECPIGTTVR
HLPN*RTGTYIIKLQI*LIQINCSSYGLNYLE*LK*RLFF*LYNTIS*SHSRNNNICAGC
SLCKAPTFTDDX


Contact:

pr8y@virginia.edu