>MYB-related_66  [length=997] [hit_def=putative MYB transcription factor [Cucumis sativus]] [comment=full length] [delivery_date=2007-05-03]
CCCATATCTGATATCGCTGTATCTGGGAATTGTCACTAGCACTAATATTG
TCAGTTCCATATCTACCCCGAGACAGTACTGAGCCAAGCTCATAGGGGTA
CGAGCTGCGGTTATAAGACGATCCAAACGCCATCAAGGCTCCATCATTTG
AGTTCTGAAACGGGTTGTTAACCGCAAAAGAAGATAGAGATTTATTATTG
TTGCTGCTGTTTAGATTGTTGTCGGACAAGTCGATGTTGGTGAGATTGAC
AGTAGTAATGTCATGGATGCTAGGTCTCCTCTTATCTTTTCCTCCTGAAA
GCTGTCTCAAATAGTATTTTTGAGCATGACTCGCTACTTGTGTTGGCGTT
TTTGAGATCACGAAATTCCTTGATATGTTCCTCCAGTCCCCTTTCCCATG
CTTGTCAAGTCCCATCAGAAACCTCCTACAACACCATTGTTTGTTAACAT
CAAAATCAACCAGTTCTACATATTAAACCAACAATATAATGAGCTTAAAC
TTATATTTAAGAATTTTTTTTACACTATCAGGTTAGCTTTATCGACTGTA
ACAGCTCATTTACCAATCAGAATAGGAATTGGCTCTGAGTTCACATATAG
GATCAGACACACTACATGAAATTGGAAATAAGAAAAGGTAGTTGTGCACC
TGTGTTCTTCCTCAGTCCATGGGACACCTTTTTTTCTTTCTTGATCATAA
CATCTGCCTCTCTTTTTAAACGATTGAACACCGCGATGATGATGATCATC
GACCAAATCAAGCATAAAAGACGAGGTGAAATACGTAGGAGGAACCGGGA
ACAAGCCAGCTTCTATGTCACTAACATCTGCTGCTAATTCTTTGTACTGT
TTCATCACATCATACACTGTCTTCCCAGGTATCAAATCCGCCACCTTAAA
CCATCTATTCGGAGTTGTCTCATCGTATATTGCAAGTGCACTTTCAAACT
TCTTGTTCTCTTCTTGTGTCCATTCACTGCTTTTCCTCTGTTCCATC


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_66 CAI30890 2.58815e-32 141.739 putative MYB transcription factor [Cucumis sativus]
MYB-related_66 AAL78741 2.26733e-28 128.642 MYB-like transcription factor DIVARICATA [Antirrhinum majus]
MYB-related_66 AAC27179 1.12526e-27 126.331 putative MYB family transcription factor [Arabidopsis thaliana]
MYB-related_66 AAS09999 1.12526e-27 126.331 MYB transcription factor [Arabidopsis thaliana]
MYB-related_66 BAC42760 1.12526e-27 126.331 putative MYB family transcription factor [Arabidopsis thaliana]
MYB-related_66 CAI30890 4.89236e-23 110.923 putative MYB transcription factor [Cucumis sativus]
MYB-related_66 AAL78741 6.38963e-23 110.538 MYB-like transcription factor DIVARICATA [Antirrhinum majus]
MYB-related_66 AAS09999 5.40914e-22 107.457 MYB transcription factor [Arabidopsis thaliana]
MYB-related_66 BAC42760 5.40914e-22 107.457 putative MYB family transcription factor [Arabidopsis thaliana]
MYB-related_66 AAC27179 5.40914e-22 107.457 putative MYB family transcription factor [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET043570

ET049364

ET049082

ET041680

ET048254

ET042784

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_66
>MYB-related_66_1 [tobfac_id=MYB-related_66] [frame=1]
PISDIAVSGNCH*H*YCQFHIYPETVLSQAHRGTSCGYKTIQTPSRLHHLSSETGC*PQK
KIEIYYCCCCLDCCRTSRCW*D*Q**CHGC*VSSYLFLLKAVSNSIFEHDSLLVLAFLRS
RNSLICSSSPLSHACQVPSETSYNTIVC*HQNQPVLHIKPTI**A*TYI*EFFLHYQVSF
IDCNSSFTNQNRNWL*VHI*DQTHYMKLEIRKGSCAPVFFLSPWDTFFSFLIITSASLFK
RLNTAMMMIIDQIKHKRRGEIRRRNREQASFYVTNICC*FFVLFHHIIHCLPRYQIRHLK
PSIRSCLIVYCKCTFKLLVLFLCPFTAFPLFHX
>MYB-related_66_2 [tobfac_id=MYB-related_66] [frame=2]
PYLISLYLGIVTSTNIVSSISTPRQY*AKLIGVRAAVIRRSKRHQGSII*VLKRVVNRKR
R*RFIIVAAV*IVVGQVDVGEIDSSNVMDARSPLIFSS*KLSQIVFLSMTRYLCWRF*DH
EIP*YVPPVPFPMLVKSHQKPPTTPLFVNIKINQFYILNQQYNELKLIFKNFFYTIRLAL
STVTAHLPIRIGIGSEFTYRIRHTT*NWK*EKVVVHLCSSSVHGTPFFLS*S*HLPLFLN
D*TPR***SSTKSSIKDEVKYVGGTGNKPASMSLTSAANSLYCFITSYTVFPGIKSATLN
HLFGVVSSYIASALSNFLFSSCVHSLLFLCSI
>MYB-related_66_3 [tobfac_id=MYB-related_66] [frame=3]
HI*YRCIWELSLALILSVPYLPRDSTEPSS*GYELRL*DDPNAIKAPSFEF*NGLLTAKE
DRDLLLLLLFRLLSDKSMLVRLTVVMSWMLGLLLSFPPESCLK*YF*A*LATCVGVFEIT
KFLDMFLQSPFPCLSSPIRNLLQHHCLLTSKSTSSTY*TNNIMSLNLYLRIFFTLSG*LY
RL*QLIYQSE*ELALSSHIGSDTLHEIGNKKR*LCTCVLPQSMGHLFFFLDHNICLSF*T
IEHRDDDDHRPNQA*KTR*NT*EEPGTSQLLCH*HLLLILCTVSSHHTLSSQVSNPPP*T
IYSELSHRILQVHFQTSCSLLVSIHCFSSVPS
>MYB-related_66_4 [tobfac_id=MYB-related_66] [frame=-1]
MEQRKSSEWTQEENKKFESALAIYDETTPNRWFKVADLIPGKTVYDVMKQYKELAADVSD
IEAGLFPVPPTYFTSSFMLDLVDDHHHRGVQSFKKRGRCYDQERKKGVPWTEEEHRCTTT
FSYFQFHVVCLILYVNSEPIPILIGK*AVTVDKANLIV*KKFLNISLSSLYCWFNM*NWL
ILMLTNNGVVGGF*WDLTSMGKGTGGTYQGIS*SQKRQHK*RVMLKNTI*DSFQEEKIRG
DLASMTLLLSISPTSTCPTTI*TAATIINLYLLLRLTTRFRTQMMEP*WRLDRLITAART
PMSLAQYCLGVDMELTILVLVTIPRYSDIRYG
>MYB-related_66_5 [tobfac_id=MYB-related_66] [frame=-2]
DGTEEKQ*MDTRREQEV*KCTCNIR*DNSE*MV*GGGFDTWEDSV*CDETVQRISSRC**
HRSWLVPGSSYVFHLVFYA*FGR*SSSSRCSIV*KERQML*SRKKKRCPMD*GRTQVHNY
LFLFPISCSVSDPICELRANSYSDW*MSCYSR*S*PDSVKKILKYKFKLIILLV*YVELV
DFDVNKQWCCRRFLMGLDKHGKGDWRNISRNFVISKTPTQVASHAQKYYLRQLSGGKDKR
RPSIHDITTVNLTNIDLSDNNLNSSNNNKSLSSFAVNNPFQNSNDGALMAFGSSYNRSSY
PYELGSVLSRGRYGTDNISASDNSQIQRYQIWX
>MYB-related_66_6 [tobfac_id=MYB-related_66] [frame=-3]
WNRGKAVNGHKKRTRSLKVHLQYTMRQLRIDGLRWRI*YLGRQCMM**NSTKN*QQMLVT
*KLACSRFLLRISPRLLCLIWSMIIIIAVFNRLKREADVMIKKEKKVSHGLRKNTGAQLP
FLISNFM*CV*SYM*TQSQFLF*LVNELLQSIKLT**CKKNS*I*V*AHYIVGLICRTG*
F*C*QTMVL*EVSDGT*QAWERGLEEHIKEFRDLKNANTSSESCSKILFETAFRRKR*EE
T*HP*HYYCQSHQHRLVRQQSKQQQQ**ISIFFCG*QPVSELK*WSLDGVWIVL*PQLVP
L*AWLSTVSG*IWN*QY*C**QFPDTAISDMG


Contact:

pr8y@virginia.edu