>MYB-related_67  [length=1287] [hit_def=KT7C.112N09F.051221T7 KT7 Nicotiana tabacum cDNA clone KT7C.112N09, mRNA sequence] [comment=3 prime half] [delivery_date=2007-05-03]
CTTTTGGCTGCTAATGTACTCGAATTGCAAAAAAGATGCCAAAAATAACC
CCTTGTACGTTGTGCAAAAGAATTGTTGATTAACCCCTCAAAACCATATA
GAAACTAAACTCTAGTATTTACAAATTTCTTAATCGCATTAAAAAAGAAC
AATTGGAACAACTAAAAGATACTTAAAACAAGGCACGAGCCTTCAAAAAT
TCAGTTTCAGCAGCAGCTAAAAACATTTATGTTATGACTCTATAGTCTAT
AGAATTAGAAAGAAAAAAAAAAAATTCCAATAATATGCACAATTTACTAG
TGCATAGGTGGCGGGTGCGGCGGCGGTAGGGGGTATGCAACTGGAAGAAC
ATAAGGAGGATGGTGTCCATGAGGAAGCATAACCGGAGTTCCGACGGCCG
ACGCCATGTGAGTCGGTGGAGCAGCAACGGGATGTCCCATCGGAGCACCG
TACATGCCGAAACCATGCATATTGGGCTGATTTCTATGCTTGATATTGGG
CCCAAGTGCTGCTGGATTTGATGGATTTGGATTGGGCTGTTGGCCCGTAA
TAGGAGCCTGATGAGTTGAAATATCTCCACCGTTAATACTTGTAATATCA
TGAATACTTGACCTTCTTCTATCTCTATTCATTGAATTTAATCGAATAAA
GTACTTTTGGGCATGACTAGCCACTTGTGTTGGTGTTCTTGATATCACAA
AATTCCTTGAAATACTCCTCCAATCTCCTTTCCCAAATTTATCTAAACCT
AGCAAAAATAACCTGTAAACCAAATAAAGGGATAAAATCAGACATAGGAT
TAAGAAATGAAAATTAACCCAAATAACCATACAACTAATCTCTTAAATTA
AAAAAAAAAAAAAACTGCTGGCAGATGTATAATATATATACAATTCATGC
ATAATATATATATAATTATGTATAATTTATCAATACCGGCTAATAAAAAT
AAACATTAAATTTGGCCAGCTATTTGTATAACAATCCCATTAGAAATTAT
CTAAACTAGTGCAACAATAACAATAATTATACTTCAATTCGAAACAAATT
AGGGTTGCCTGAACGAATCATTCCCGACAACATTACTCTGGTTAAACTCA
TCTCATATCAAATAGTATGCACATAAAAATAAATTGTATAACTAAAAAAT
CTCTGAAAGAATTAACCACTCCTAAGAAGCATAGGATATATAGTAAAAAT
TCTAAACTCTAAATTAGTGCAATTGAATTTCTTTTTTACTGTGGTACCTA
TAGTAAAAGTTGTAACATCTAAATTTGTGCAATAATA


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition
MYB-related_67 EB451887 0 842.993 KT7C.112N09F.051221T7 KT7 Nicotiana tabacum cDNA clone KT7C.112N09, mRNA sequence


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_67 AAM63950 4.58454e-30 134.806 unknown [Arabidopsis thaliana]
MYB-related_67 AAF69713 4.58454e-30 134.806 F27J15.20 [Arabidopsis thaliana]
MYB-related_67 AAS09998 4.58454e-30 134.806 MYB transcription factor [Arabidopsis thaliana]
MYB-related_67 CAE05757 4.291e-28 128.257 OSJNBa0064G10.8 [Oryza sativa (japonica cultivar-group)]
MYB-related_67 BAC05661 2.1296e-27 125.946 putative syringolide-induced protein 1-3-1B [Oryza sativa (japonica cultivar-group)]


Component TGI GSRs via NCBI:

ET041907

ET048788

ET043744

ET043461

ET051896

ET051898

ET051876

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_67
>MYB-related_67_1 [tobfac_id=MYB-related_67] [frame=1]
LLAANVLELQKRCQK*PLVRCAKELLINPSKPYRN*TLVFTNFLIALKKNNWNN*KILKT
RHEPSKIQFQQQLKTFML*LYSL*N*KEKKKIPIICTIY*CIGGGCGGGRGYATGRT*GG
WCP*GSITGVPTADAM*VGGAATGCPIGAPYMPKPCILG*FLCLILGPSAAGFDGFGLGC
WPVIGA**VEISPPLILVIS*ILDLLLSLFIEFNRIKYFWA*LATCVGVLDITKFLEILL
QSPFPNLSKPSKNNL*TK*RDKIRHRIKK*KLTQITIQLIS*IKKKKKLLADV*YIYNSC
IIYI*LCIIYQYRLIKINIKFGQLFV*QSH*KLSKLVQQ*Q*LYFNSKQIRVA*TNHSRQ
HYSG*THLISNSMHIKINCITKKSLKELTTPKKHRIYSKNSKL*ISAIEFLFYCGTYSKS
CNI*ICAII
>MYB-related_67_2 [tobfac_id=MYB-related_67] [frame=2]
FWLLMYSNCKKDAKNNPLYVVQKNC*LTPQNHIETKL*YLQIS*SH*KRTIGTTKRYLKQ
GTSLQKFSFSSS*KHLCYDSIVYRIRKKKKKFQ*YAQFTSA*VAGAAAVGGMQLEEHKED
GVHEEA*PEFRRPTPCESVEQQRDVPSEHRTCRNHAYWADFYA*YWAQVLLDLMDLDWAV
GP**EPDELKYLHR*YL*YHEYLTFFYLYSLNLIE*STFGHD*PLVLVFLISQNSLKYSS
NLLSQIYLNLAKITCKPNKGIKSDIGLRNEN*PK*PYN*SLKLKKKKNCWQMYNIYTIHA
*YIYNYV*FINTG**K*TLNLASYLYNNPIRNYLN*CNNNNNYTSIRNKLGLPERIIPDN
ITLVKLISYQIVCT*K*IV*LKNL*KN*PLLRSIGYIVKILNSKLVQLNFFFTVVPIVKV
VTSKFVQ*X
>MYB-related_67_3 [tobfac_id=MYB-related_67] [frame=3]
FGC*CTRIAKKMPKITPCTLCKRIVD*PLKTI*KLNSSIYKFLNRIKKEQLEQLKDT*NK
ARAFKNSVSAAAKNIYVMTL*SIELERKKKNSNNMHNLLVHRWRVRRR*GVCNWKNIRRM
VSMRKHNRSSDGRRHVSRWSSNGMSHRSTVHAETMHIGLISMLDIGPKCCWI*WIWIGLL
ARNRSLMS*NISTVNTCNIMNT*PSSISIH*I*SNKVLLGMTSHLCWCS*YHKIP*NTPP
ISFPKFI*T*QK*PVNQIKG*NQT*D*EMKINPNNHTTNLLN*KKKKTAGRCIIYIQFMH
NIYIIMYNLSIPANKNKH*IWPAICITIPLEII*TSATITIIILQFETN*GCLNESFPTT
LLWLNSSHIK*YAHKNKLYN*KISERINHS*EA*DI**KF*TLN*CN*ISFLLWYL**KL
*HLNLCNNX
>MYB-related_67_4 [tobfac_id=MYB-related_67] [frame=-1]
YYCTNLDVTTFTIGTTVKKKFNCTNLEFRIFTIYPMLLRSG*FFQRFFSYTIYFYVHTI*
YEMSLTRVMLSGMIRSGNPNLFRIEV*LLLLLH*FR*FLMGLLYK*LAKFNVYFY*PVLI
NYT*LYIYYA*IVYILYICQQFFFFFNLRD*LYGYLG*FSFLNPMSDFIPLFGLQVIFAR
FR*IWERRLEEYFKEFCDIKNTNTSG*SCPKVLYSIKFNE*R*KKVKYS*YYKY*RWRYF
NSSGSYYGPTAQSKSIKSSSTWAQYQA*KSAQYAWFRHVRCSDGTSRCCSTDSHGVGRRN
SGYASSWTPSSLCSSSCIPPTAAAPATYALVNCAYYWNFFFFFLIL*TIES*HKCF*LLL
KLNF*RLVPCFKYLLVVPIVLF*CD*EICKY*SLVSIWF*GVNQQFFCTTYKGLFLASFL
QFEYISSQK
>MYB-related_67_5 [tobfac_id=MYB-related_67] [frame=-2]
LLHKFRCYNFYYRYHSKKEIQLH*FRV*NFYYISYAS*EWLILSEIF*LYNLFLCAYYLI
*DEFNQSNVVGNDSFRQP*FVSN*SIIIVIVALV*IISNGIVIQIAGQI*CLFLLAGIDK
LYIIIYILCMNCIYIIHLPAVFFFF*FKRLVVWLFGLIFIS*SYV*FYPFIWFTGYFC*V
*INLGKEIGGVFQGIL*YQEHQHKWLVMPKSTLFD*IQ*IEIEEGQVFMILQVLTVEIFQ
LIRLLLRANSPIQIHQIQQHLGPISSIEISPICMVSACTVLRWDIPLLLHRLTWRRPSEL
RLCFLMDTILLMFFQLHTPYRRRTRHLCTSKLCILLEFFFFLSNSIDYRVIT*MFLAAAE
TEFLKARALF*VSFSCSNCSFLMRLRNL*ILEFSFYMVLRG*STILLHNVQGVIFGIFFA
IRVH*QPKX
>MYB-related_67_6 [tobfac_id=MYB-related_67] [frame=-3]
IIAQI*MLQLLL*VPQ*KRNSIALI*SLEFLLYILCFLGVVNSFRDFLVIQFIFMCILFD
MR*V*PE*CCRE*FVQATLICFELKYNYCYCCTSLDNF*WDCYTNSWPNLMFIFISRY**
IIHNYIYIMHELYIYYTSASSFFFFLI*EISCMVIWVNFHFLILCLILSLYLVYRLFLLG
LDKFGKGDWRSISRNFVISRTPTQVASHAQKYFIRLNSMNRDRRRSSIHDITSINGGDIS
THQAPITGQQPNPNPSNPAALGPNIKHRNQPNMHGFGMYGAPMGHPVAAPPTHMASAVGT
PVMLPHGHHPPYVLPVAYPLPPPHPPPMH**IVHIIGIFFFSF*FYRL*SHNINVFSCC*
N*IFEGSCLVLSIF*LFQLFFFNAIKKFVNTRV*FLYGFEGLINNSFAQRTRGYFWHLFC
NSSTLAAKX


Contact:

pr8y@virginia.edu