>MYB-related_70  [length=1324] [hit_def=KN6B.101D21F.051230T7 KN6B Nicotiana tabacum cDNA clone KN6B.101D21, mRNA sequence] [comment=full length] [delivery_date=2007-05-03]
GTCAGTGTTCATAAAATTTGATCTCTTTTGAAAAAGCAAGTATAAAAATA
AGAACTTGACACCAAGGAAAAATCTTTTTAAAGCTTACACTAAAAAGTAC
TTCAAATTCTCAAGGCACAACAGAAAAAGATGCAAACTGAAAAAACAACA
AGACCCAGCAGGCCAGCACCAATATCAATTCAAGAAAAGGAAAAACTTAC
AATGAGAATTAAAATACTACCTCTGTTTAAAAAGAGTGATAGGATCGACC
TACAAAAATCAAACCATCTAGTTTTCTCCCTCAATAATGATATCAGTTCC
TTTATTTTATCTAAAACAGTCAACACACAATGGCTTACCACCTAAACAAG
TGATTTCAACTAGTACAGGGTTAAAAGGAGAGAAAAAATATAGTTAAAAG
AAATTGTTTTGACTTTTCGTTAATAATAATGGTGAGATAAAATAAGTTTG
ATAAAGGAAGACATGATTGAGTGCAAGTACCGAGTCAGTGGTGATATCAA
AGAGGCTAGATCGGCGGCGACGACGGTTGAGGTTGCTTCGTCGGAGGAAG
TACTTCTGAGCATGACTTGCAACCTGTGTCGGTGTACGTGTCTTTACGAA
GTTTCTAGAGATTCCTCTCCAGTCTCCTTTCCCCACTTTCTGCAATCCTA
ATAGGAATAACTTGTGCTCTTCCTCCGTCCATGGTACTCCTTTATACAAA
ACCAAAACAACCGCAGCTCCATCAAAAATCAATCTTTAGGGGAAATGAAC
TTTTGTACAAGATCTAATTTTTTCTATGATTCGACATCAATTTTTGAAGT
TTTGTTTTTAAAAATAAAATTTACATAACATAAATCACAACTTTTGTATG
GTTAAACAATACAAATTTGACTCTGTACCAAACAAATTAGGAAGAAAGTA
TAAATAAAACAATTGTGCAAAAAGAGGGGACACGATCGATGAATCTACTA
GAAAGTTGACTCAAGAGAAACATTAATTGCCCAATAACGGAGAGAAACAA
TTGAATCAAAGACGAAAAAAGAAATTCTGCAATTGTAAAAAGCGGAAAAT
AACATCAATTTTTCACGAAAGACAATCAATAATTCGATAGCAAAAAGAAA
ATAATAGGATGAGAGATCTCACCTCGCTTACGCTCGCGACCGCTGTTGGA
GTGGTGTTGAACAGCGTCATCTGCAGAGGCATATCCTTCCTCAGCCACTT
TAGATGTATCAGCGCTGTTGTTAGCATTTGGCTGTTCGTACTGTGAGAGA
TTGTTCANACTGACGCTCTTCCTCATAGGATCCACTTTTACTCTCACACC
AAACAGCATGATTTCTCCTCCTAC


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition
MYB-related_70 EB438608 8.01316e-118 424.717 KN6B.101D21F.051230T7 KN6B Nicotiana tabacum cDNA clone KN6B.101D21, mRNA sequence
MYB-related_70 EB451584 8.01316e-118 424.717 KT7C.110P24F.051221T7 KT7 Nicotiana tabacum cDNA clone KT7C.110P24, mRNA sequence
MYB-related_70 EB451584 1.81249e-109 396.964 KT7C.110P24F.051221T7 KT7 Nicotiana tabacum cDNA clone KT7C.110P24, mRNA sequence
MYB-related_70 EB438608 1.81249e-109 396.964 KN6B.101D21F.051230T7 KN6B Nicotiana tabacum cDNA clone KN6B.101D21, mRNA sequence
MYB-related_70 EB439822 2.82991e-108 392.999 KN6B.104J05F.060103T7 KN6B Nicotiana tabacum cDNA clone KN6B.104J05, mRNA sequence
MYB-related_70 EB451633 2.82991e-108 392.999 KT7C.112C04F.051221T7 KT7 Nicotiana tabacum cDNA clone KT7C.112C04, mRNA sequence
MYB-related_70 DW000457 2.82991e-108 392.999 KL4B.105O02F.051104T7 KL4B Nicotiana tabacum cDNA clone KL4B.105O02, mRNA sequence


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_70 ABB86258 2.99414e-24 115.546 putative DNA binding protein-like [Solanum tuberosum]
MYB-related_70 AAX95766 2.99414e-24 115.546 putative DNA binding protein [Lycopersicon esculentum]
MYB-related_70 AAO45179 4.32353e-23 111.694 transcription factor Myb1 [Malus xiaojinensis]
MYB-related_70 AAX95766 1.64294e-22 109.768 putative DNA binding protein [Lycopersicon esculentum]
MYB-related_70 AAD55292 2.14575e-22 109.383 Contains PF|00249 Myb-like DNA-binding domain. EST gb|Z18152 comes from this gene. [Arabidopsis thaliana]
MYB-related_70 AAG51937 2.14575e-22 109.383 putative MYB family transcription factor; 86049-87165 [Arabidopsis thaliana]
MYB-related_70 ABB86258 3.66009e-22 108.612 putative DNA binding protein-like [Solanum tuberosum]
MYB-related_70 AAO45179 3.21384e-10 68.9366 transcription factor Myb1 [Malus xiaojinensis]
MYB-related_70 AAD55292 6.06104e-09 64.6994 Contains PF|00249 Myb-like DNA-binding domain. EST gb|Z18152 comes from this gene. [Arabidopsis thaliana]
MYB-related_70 AAG51937 6.06104e-09 64.6994 putative MYB family transcription factor; 86049-87165 [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET047499

ET050344

ET045103

ET048697

ET051390

ET049956

ET048354

ET047268

ET045911

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_70
>MYB-related_70_1 [tobfac_id=MYB-related_70] [frame=1]
VSVHKI*SLLKKQV*K*ELDTKEKSF*SLH*KVLQILKAQQKKMQTEKTTRPSRPAPISI
QEKEKLTMRIKILPLFKKSDRIDLQKSNHLVFSLNNDISSFILSKTVNTQWLTT*TSDFN
*YRVKRREKI*LKEIVLTFR***W*DKISLIKEDMIECKYRVSGDIKEARSAATTVEVAS
SEEVLLSMTCNLCRCTCLYEVSRDSSPVSFPHFLQS**E*LVLFLRPWYSFIQNQNNRSS
IKNQSLGEMNFCTRSNFFYDSTSIFEVLFLKIKFT*HKSQLLYG*TIQI*LCTKQIRKKV
*IKQLCKKRGHDR*IY*KVDSRETLIAQ*RRETIESKTKKEILQL*KAENNINFSRKTIN
NSIAKRK**DERSHLAYARDRCWSGVEQRHLQRHILPQPL*MYQRCC*HLAVRTVRDCSX
*RSSS*DPLLLSHQTA*FLLLX
>MYB-related_70_2 [tobfac_id=MYB-related_70] [frame=2]
SVFIKFDLF*KSKYKNKNLTPRKNLFKAYTKKYFKFSRHNRKRCKLKKQQDPAGQHQYQF
KKRKNLQ*ELKYYLCLKRVIGSTYKNQTI*FSPSIMISVPLFYLKQSTHNGLPPKQVIST
STGLKGEKKYS*KKLF*LFVNNNGEIK*V**RKT*LSASTESVVISKRLDRRRRRLRLLR
RRKYF*A*LATCVGVRVFTKFLEIPLQSPFPTFCNPNRNNLCSSSVHGTPLYKTKTTAAP
SKINL*GK*TFVQDLIFSMIRHQFLKFCF*K*NLHNINHNFCMVKQYKFDSVPNKLGRKY
K*NNCAKRGDTIDESTRKLTQEKH*LPNNGEKQLNQRRKKKFCNCKKRKITSIFHERQSI
IR*QKENNRMRDLTSLTLATAVGVVLNSVICRGISFLSHFRCISAVVSIWLFVL*EIVXT
DALPHRIHFYSHTKQHDFSSY
>MYB-related_70_3 [tobfac_id=MYB-related_70] [frame=3]
QCS*NLISFEKASIKIRT*HQGKIFLKLTLKSTSNSQGTTEKDAN*KNNKTQQASTNINS
RKGKTYNEN*NTTSV*KE**DRPTKIKPSSFLPQ**YQFLYFI*NSQHTMAYHLNK*FQL
VQG*KERKNIVKRNCFDFSLIIMVR*NKFDKGRHD*VQVPSQW*YQRG*IGGDDG*GCFV
GGSTSEHDLQPVSVYVSLRSF*RFLSSLLSPLSAILIGITCALPPSMVLLYTKPKQPQLH
QKSIFRGNELLYKI*FFL*FDINF*SFVFKNKIYIT*ITTFVWLNNTNLTLYQTN*EESI
NKTIVQKEGTRSMNLLES*LKRNINCPITERNN*IKDEKRNSAIVKSGK*HQFFTKDNQ*
FDSKKKIIG*EISPRLRSRPLLEWC*TASSAEAYPSSATLDVSALLLAFGCSYCERLFXL
TLFLIGSTFTLTPNSMISPPT
>MYB-related_70_4 [tobfac_id=MYB-related_70] [frame=-1]
*EEKSCCLV*E*KWIL*GRASV*TISHSTNSQMLTTALIHLKWLRKDMPLQMTLFNTTPT
AVASVSEVRSLILLFSFCYRIIDCLS*KIDVIFRFLQLQNFFFRL*FNCFSPLLGN*CFS
*VNFLVDSSIVSPLFAQLFYLYFLPNLFGTESNLYCLTIQKL*FMLCKFYF*KQNFKN*C
RIIEKIRSCTKVHFP*RLIFDGAAVVLVLYKGVPWTEEEHKLFLLGLQKVGKGDWRGISR
NFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVLALNHVFLYQTYFISPLL
LTKSQNNFF*LYFFSPFNPVLVEITCLGGKPLCVDCFR*NKGTDIIIEGEN*MV*FL*VD
PITLFKQR*YFNSHCKFFLFLN*YWCWPAGSCCFFSLHLFLLCLENLKYFLV*ALKRFFL
GVKFLFLYLLFQKRSNFMNTD
>MYB-related_70_5 [tobfac_id=MYB-related_70] [frame=-2]
VGGEIMLFGVRVKVDPMRKSVSXNNLSQYEQPNANNSADTSKVAEEGYASADDAVQHHSN
SGRERKRGEISHPIIFFLLSNY*LSFVKN*CYFPLFTIAEFLFSSLIQLFLSVIGQLMFL
LSQLSSRFIDRVPSFCTIVLFILSS*FVWYRVKFVLFNHTKVVIYVM*ILFLKTKLQKLM
SNHRKN*ILYKSSFPLKIDF*WSCGCFGFV*RSTMDGGRAQVIPIRIAESGERRLERNL*
KLRKDTYTDTGCKSCSEVLPPTKQPQPSSPPI*PL*YHH*LGTCTQSCLPLSNLFYLTII
INEKSKQFLLTIFFLSF*PCTS*NHLFRW*AIVC*LF*IK*RN*YHY*GRKLDGLIFVGR
SYHSF*TEVVF*FSL*VFPFLELILVLACWVLLFFQFASFSVVP*EFEVLFSVSFKKIFP
WCQVLIFILAFSKEIKFYEH*X
>MYB-related_70_6 [tobfac_id=MYB-related_70] [frame=-3]
RRRNHAVWCESKSGSYEEERQXEQSLTVRTAKC*QQR*YI*SG*GRICLCR*RCSTPLQQ
RSRA*AR*DLSSYYFLFAIELLIVFREKLMLFSAFYNCRISFFVFDSIVSLRYWAINVSL
ESTF**IHRSCPLFLHNCFIYTFFLICLVQSQICIV*PYKSCDLCYVNFIFKNKTSKIDV
ES*KKLDLVQKFISPKD*FLMELRLFWFCIKEYHGRRKSTSYSY*DCRKWGKETGEESLE
TS*RHVHRHRLQVMLRSTSSDEATSTVVAADLASLISPLTRYLHSIMSSFIKLILSHHYY
*RKVKTISFNYIFSLLLTLY*LKSLV*VVSHCVLTVLDKIKELISLLREKTRWFDFCRSI
LSLFLNRGSILILIVSFSFS*IDIGAGLLGLVVFSVCIFFCCALRI*STF*CKL*KDFSL
VSSSYFYTCFFKRDQIL*TLT


Contact:

pr8y@virginia.edu