>MYB-related_85  [length=457] [hit_def=unnamed protein product [Arabidopsis thaliana]] [comment=appears to have 2 MYB-related domains and closest match has four domains.] [delivery_date=2007-05-03]
ATTAATGGGGATACCAAATCGCCTTCTTAGTGGTGCTTCTGTTATCATTA
GTTAAGTGTTTAAGGTGCTTTGAATTTGATTTTTCTGCTATCATTAGTTG
AATGGTCACTTATCCTCTTTCTTACATCCCTTCAGGTGGTTGAACTGGGA
AGACCCCTTAATTAAACATGAAGAGTGGGCTATATTAGAGGAAAAGGCCC
TTTTGCATGCTGTCCAGCGGAATGAAATGAGTAACTGGGTTGATATTTCT
GCATCATTAGGAGTATGTAGGACTCCGTTTCAGTGCTTATCACATTATCA
GAGGAGTCTGAATGCTTCAATCCTTAGGCGGGAATGGACAGAGGAGGAGG
ATATTAAACTCTGTGCTGCTGTGGAGACTTTTGGTGAGAGTAACTGGCAG
CTTGTTGCTTCTGTAATTGAGGGCCGGACAGGTCCCCAGTGCTCCAATAG
GTCAGTC


Pfam accession: Myb_DNA-binding
Brief BLAST results against the "ESTobacco" dataset.

TOBFAC ID Accesion E Value Bit Score Definition


Brief BLAST results against the "GenBank Protein" dataset.

TOBFAC ID Accession E Value Bit Score Definition
MYB-related_85 BAB02022 9.95046e-33 140.969 unnamed protein product [Arabidopsis thaliana]
MYB-related_85 AAK56549 9.95046e-33 140.969 putative transcription factor [Arabidopsis thaliana]
MYB-related_85 AAS10122 9.95046e-33 140.969 MYB transcription factor [Arabidopsis thaliana]
MYB-related_85 BAC79618 1.10015e-31 137.502 basal transcription factor SNAPc large chain SNAP190-like protein [Oryza sativa (japonica cultivar-group)]
MYB-related_85 AAF25950 8.19682e-11 68.1662 putative c-myb-like transcription factor [Arabidopsis thaliana]


Component TGI GSRs via NCBI:

ET044651

Papers related to tobacco and family MYB-related:

Suzuki K, Nishiuchi T, Nakayama Y, Ito M, Shinshi H Elicitor-induced down-regulation of cell cycle-related genes in tobacco cells PLANT CELL AND ENVIRONMENT 29 (2): 183-191 2006 PMID: 17080634

Rowland,O., Ludwig,A.A., Merrick,C.J., Baillieul,F., Tracy,F.E., Durrant,W.E., Fritz-Laylin,L., Nekrasov,V., Sjolander,K., Yoshioka,H. and Jones,J.D. Functional Analysis of Avr9/Cf-9 Rapidly Elicited Genes Identifies a Protein Kinase, ACIK1, That Is Essential for Full Cf-9-Dependent Disease Resistance in Tomato PLANT CELL 17 (1): 295-310 2005 PMID: 15598806

McHale NA, Koning RE. PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves. PLANT CELL 16 (5):1251-62 2004 PMID: 15084717

Araki S, Ito M, Soyano T, Nishihama R, Machida Y Mitotic cyclins stimulate the activity of c-Myb-like factors for transactivation of G(2)/M phase-specific genes in tobacco JOURNAL OF BIOLOGICAL CHEMISTRY 279 (31): 32979-32988 2004 PMID: 15175336

Kyo,M., Hattori,S., Yamaji,N., Pechan,P. and Fukui,H. Cloning and characterization of cDNAs associated with the embryogenic dedifferentiation of tobacco immature pollen grains PLANT SCIENCE 164: 1057-1066 2003 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TBH-486BPW1-1&_user=709071&_coverDate=06%2F30%2F2003&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000039638&_version=1&_urlVersion=0&_userid=709071&md5=bea469f86d86456acadea8f5326b36e9

Ito M, Araki S, Matsunaga S, Itoh T, Nishihama R, Machida Y, Doonan JH, Watanabe A G2/M-phase-specific transcription during the plant cell cycle is mediated by c-Myb-like transcription factors PLANT CELL 13 (8): 1891-1905 2001 PMID: 11487700

Yang,S., Sweetman,J.P., Amirsadeghi,S., Barghchi,M., Huttly,A.K., Chung,W.I. and Twell,D. Novel anther-specific myb genes from tobacco as putative regulators of phenylalanine ammonia-lyase expression PLANT PHYSIOLOGY 126 (4): 1738-1753 2001 PMID: 11500571

Sugimoto,K., Takeda,S. and Hirochika,H. MYB-related transcription factor NtMYB2 induced by wounding and elicitors is a regulator of the tobacco retrotransposon Tto1 and defense-related genes PLANT CELL 12 (12): 2511-2528 2000 PMID: 11148294

Payne T, Clement J, Arnold D, Lloyd A Heterologous myb genes distinct from GL1 enhance trichome production when overexpressed in Nicotiana tabacum DEVELOPMENT 126 (4): 671-682 1999 PMID: 9895315

Yang,Y. and Klessig,D.F. Isolation and characterization of a tobacco mosaic virus-inducible myb oncogene homolog from tobacco PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 93 (25): 14972-14977 1996 PMID: 8962166



Tobacco published genes related to transcription factor family MYB-related
Family Genbank ID Name PMID


Six frame translation of MYB-related_85
>MYB-related_85_1 [tobfac_id=MYB-related_85] [frame=1]
INGDTKSPS*WCFCYH*LSV*GALNLIFLLSLVEWSLILFLTSLQVVELGRPLN*T*RVG
YIRGKGPFACCPAE*NE*LG*YFCIIRSM*DSVSVLITLSEESECFNP*AGMDRGGGY*T
LCCCGDFW*E*LAACCFCN*GPDRSPVLQ*VSX
>MYB-related_85_2 [tobfac_id=MYB-related_85] [frame=2]
LMGIPNRLLSGASVIIS*VFKVL*I*FFCYH*LNGHLSSFLHPFRWLNWEDPLIKHEEWA
ILEEKALLHAVQRNEMSNWVDISASLGVCRTPFQCLSHYQRSLNASILRREWTEEEDIKL
CAAVETFGESNWQLVASVIEGRTGPQCSNRSV
>MYB-related_85_3 [tobfac_id=MYB-related_85] [frame=3]
*WGYQIAFLVVLLLSLVKCLRCFEFDFSAIIS*MVTYPLSYIPSGG*TGKTP*LNMKSGL
Y*RKRPFCMLSSGMK*VTGLIFLHH*EYVGLRFSAYHIIRGV*MLQSLGGNGQRRRILNS
VLLWRLLVRVTGSLLLL*LRAGQVPSAPIGQS
>MYB-related_85_4 [tobfac_id=MYB-related_85] [frame=-1]
TDLLEHWGPVRPSITEATSCQLLSPKVSTAAQSLISSSSVHSRLRIEAFRLL**CDKH*N
GVLHTPNDAEISTQLLISFRWTACKRAFSSNIAHSSCLIKGSSQFNHLKGCKKEDK*PFN
***QKNQIQSTLNT*LMITEAPLRRRFGIPIN
>MYB-related_85_5 [tobfac_id=MYB-related_85] [frame=-2]
D*PIGALGTCPALNYRSNKLPVTLTKSLHSSTEFNILLLCPFPPKD*SIQTPLIM**ALK
RSPTYS**CRNINPVTHFIPLDSMQKGLFL*YSPLFMFN*GVFPVQPPEGM*ERG*VTIQ
LMIAEKSNSKHLKHLTNDNRSTTKKAIWYPH*X
>MYB-related_85_6 [tobfac_id=MYB-related_85] [frame=-3]
LTYWSTGDLSGPQLQKQQAASYSHQKSPQQHRV*YPPPLSIPA*GLKHSDSSDNVISTET
ESYILLMMQKYQPSYSFHSAGQHAKGPFPLI*PTLHV*LRGLPSSTT*RDVRKRISDHST
NDSRKIKFKAP*TLN***QKHH*EGDLVSPLX


Contact:

pr8y@virginia.edu